CAZyme Information: MGYG000004063_01628

Basic Information

• Species: Oxalobacter sp900760095
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter; Oxalobacter sp900760095
• CAZyme ID: MGYG000004063_01628
• CAZy Family: GH102
• CAZyme Description: Membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		43835.22	9.3054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004063	2013916	MAG	United Kingdom	Europe

• Gene Location: Start: 2808; End: 3971 Strand: -

Full Sequence      

MFHKRLLSCFFLIGLTVWLAACTTTPPVIPETEQMPMEERQQVSFSDLPGWKSDNLKDVL
PAFRKSCRAIGKKKDWQDVCAKAYDIDENDTFAIRSFFETHFIPYRIANENGSETGLATG
YFEPLLKGSRVRKGKFRTALYRQPDDLLVIDLASAYPQLKGLRLRGKLDGNRVVPYETRA
EIEKSGKLAGHEIVWVDDVLDAFFLEIQGSGRVYIPESGETIRLAYANQNGRPYRSIGRY
LLDRGELKPGQASSQQIRQWIRRNPERLREVLDSNPSYVFFREERIDDPSEGPKGALGVP
LTPERSIAIDPRHIPLGAPVFVDTTRPYSSVPLQKLMLAQDTGGAIRGAVRADYFWGFGP
QAGEMAGKMKQKLKVWLLLPKQPENDK

Enzyme Prediction     

No EC number prediction in MGYG000004063_01628.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	126	282	8.4e-58	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2821	MltA	1.27e-114	43	382	13	367	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
pfam03562	MltA	6.56e-112	51	282	1	231	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	2.26e-78	126	284	1	159	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	1.29e-71	125	282	1	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	1.39e-57	117	378	117	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ45271.1	1.49e-214	1	384	1	385
ARQ77564.1	1.49e-214	1	384	1	385
QDX33897.1	1.49e-214	1	384	1	385
AKN67206.1	3.72e-163	13	381	27	402
ADJ65361.1	3.72e-163	13	381	27	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QK4_B	2.09e-111	43	380	28	346	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
7ESJ_A	1.07e-91	22	381	2	360	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
2G5D_A	2.31e-87	43	380	45	413	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2G6G_A	2.88e-85	49	380	51	413	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]
2PNW_A	3.93e-55	42	381	11	364	Crystalstructure of membrane-bound lytic murein transglycosylase from Agrobacterium tumefaciens [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	6.20e-33	119	378	119	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	6.20e-33	119	378	119	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q9KPQ4	3.02e-29	117	378	112	349	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
Q8K9A7	2.58e-23	119	378	127	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1
P57531	1.13e-22	119	378	119	356	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000040	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29