CAZyme Information: MGYG000004064_00298

Basic Information

• Species: UMGS755 sp900545185
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506; UMGS755; UMGS755 sp900545185
• CAZyme ID: MGYG000004064_00298
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000004064_4|CGC1	44507.54	7.8674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004064	2605118	MAG	United Kingdom	Europe

• Gene Location: Start: 49351; End: 50526 Strand: +

Full Sequence      

MKVLQINSVCGIKSTGRICTDLADILMQNGHDCRIAYGRETVPERYQHYALRIGTQRDVT
RHALSARFFDNAGFGSRRATQKLICDIRAYDPDVIHLHNIHGYYVNIEILFNYLKNCGKK
IVWTLHDCWSFTGHCAYFDYAGCDKWKTGCNRCPQKREYPKSDGLDASCRNYRRKKELFT
GVPNVTLVTPSHWLADLTRQSYLREYPVVVIPNGIDTEVFRPTVGNFRAEHHLENKTIIL
GVASVWDRRKGLSDFVKLSEMLDDTYKIVLVGLSKEQIQNLPGNILGIERTNSTKELAEL
YTAADVCVNPTYEDNYPTVNLEAQACGTPVITYMTGGSSESVPKNNQVPKGEFYAVAKCI
RDDAFHALAEISFDKTNNFNRYMSLYANETY

Enzyme Prediction     

No EC number prediction in MGYG000004064_00298.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03825	GT4_WcaC-like	2.79e-97	1	388	1	363	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
cd03801	GT4_PimA-like	1.14e-32	16	343	17	307	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
PRK10125	PRK10125	6.15e-26	1	331	1	334	colanic acid biosynthesis glycosyltransferase WcaC.
COG0438	RfaB	1.55e-24	1	386	3	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03807	GT4_WbnK-like	3.25e-21	82	386	70	361	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZR73927.1	2.14e-156	1	386	1	396
AJG40163.1	1.68e-155	1	348	1	346
ANQ53651.1	1.75e-152	1	386	1	396
CAI34582.1	1.10e-148	1	341	1	342
AMH89289.1	1.56e-148	1	341	1	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	2.32e-08	199	361	202	384	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71237	2.37e-21	1	345	1	348	Putative colanic acid biosynthesis glycosyl transferase WcaC OS=Escherichia coli (strain K12) OX=83333 GN=wcaC PE=4 SV=2
B8HCF8	6.85e-09	191	342	186	344	D-inositol 3-phosphate glycosyltransferase OS=Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6) OX=452863 GN=mshA PE=3 SV=1
Q4JSW2	3.79e-08	184	337	166	340	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) OX=306537 GN=mshA PE=3 SV=1
Q8DPV9	4.46e-08	179	331	136	300	Alpha-galactosylglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=cpoA PE=1 SV=1
A1R8N8	1.54e-07	154	342	150	338	D-inositol 3-phosphate glycosyltransferase OS=Paenarthrobacter aurescens (strain TC1) OX=290340 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004064_00298.