CAZyme Information: MGYG000004064_00763

Basic Information

• Species: UMGS755 sp900545185
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506; UMGS755; UMGS755 sp900545185
• CAZyme ID: MGYG000004064_00763
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1262	MGYG000004064_13|CGC2	139551.9	4.5144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004064	2605118	MAG	United Kingdom	Europe

• Gene Location: Start: 33269; End: 37057 Strand: -

Full Sequence      

MKIKNKILAVVMAAVMLAPQAGTAVFAADKPKGYVGYDFRSENTGIKPAIKYYEEGGVTW
EIADFPSKKQKSLMVSTKTMGTNWYVDVAAKSKKQFVLETSIAYTGSIGSFKRIFTCDTS
NGSYIVFFTVDKSGQLTAYDGTVLAKLREGVFTDISLLIDFEQRVCSVKINGRTKLMDVP
LGDDKFTDMYNARIQVSEIDGDGENFYIRYFRGYEGSQTVNVEQSGEDAASGNNAGATKI
RVTDEMVSERMKDNIFMTTKTGKALVNNNLTYVDEANKELAPRIIDGRTLVPLRFVSESL
GADVQYDDVTRTAVITLAGKTITVNAAGASYTVDGAAKEFDVVPRIEGDRLLVPLRAISE
AFGKEVFYDKCGYIIIGDHAASFTLDNAKDKKILDKAVRNLVFESPTAAEVTAAVKAQNP
NNEHPRLLVRRDDVTRIKEKIKNDALVASWAEELIKKADSMIGLEPINYELINVRMEVSR
TLTMRVEPLSFAYLITGDRKYANEAISNLMRVTDPTVFPDWNPYHFLDVADMCAGVAIGY
DWCYDAMTPAQRMQVKTALINYGLKEIMRDFTFDSTRKRTWAWNDPNSTAYPQNWIAVCC
GGLDMAALAIGDEADAAELSGQVIAMGLEHIKDLLAEFAPDGAWYEGPGYWEYSYEFFAY
AFASMQSALGTDYGLTNSPGFKEGPYYVIGNAGTAGCFNMNDCPEALVDSPEFFWLSNVF
SDPALTKYRLQYLNGKTTSDYKNIIWYNPDYANDETPIAEDGMWREFNVASSRTGYGTAD
LYAAIHGGEDGRDIGDLDYGEFILDMFGKRWAKDLGSEHANYVVGHEGTRWSYYRCRGEG
HNVLIFNPDGTEDQDKSAICPITQYAHNDESMYAATDLTAAHSYRGAESVVRGMYVDKAN
KCVTIQDEVKMKEPSEMYWFMHTPADIEIAEDGRTAVLTQGVYKMGVSLVGSEKLTFTQM
PAVAMEDSPHPSDSESDDSNINKLTIHAEGVTEETFAVQIYPLGGDEKPQTVNGACTPIA
DWNLLDADSLPKLTSLTVSGETIALNDYDTFYALQTKLDEFLGATFTEQKIEATGDGTVT
VIPMTADNRVAKVCIEKNGKSKTYIVSINTLSSEDVEFEQIKPDYVGKTPAGLSALKIKD
VQAAVTQAEHVPANTIDGDFNTRWTSDTIGGTIQFDLGEVKEASAMGVAFFFGNERSTFY
RAAVSEDGQTWTLVGNIKSGGDTLDLEVYKFPKQKVRYLKLSGFGNTEGSAWFNVSEVRL
YE

Enzyme Prediction     

No EC number prediction in MGYG000004064_00763.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	780	950	4.4e-40	0.9608938547486033
CBM32	1144	1257	2e-17	0.8870967741935484

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	6.70e-26	285	369	1	85	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam00754	F5_F8_type_C	1.06e-11	1147	1258	9	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07833	Cu_amine_oxidN1	8.23e-11	249	315	32	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam16332	DUF4962	1.49e-10	399	689	117	399	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
smart00231	FA58C	0.001	1154	1212	26	86	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS27107.1	1.12e-134	376	1261	654	1511
QNK58643.1	1.66e-127	402	1261	772	1609
QUH30172.1	1.60e-124	415	1262	64	894
AJA50754.1	1.57e-116	406	1024	73	680
AOZ77957.1	1.57e-116	406	1024	73	680

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D29_A	2.20e-17	1144	1261	13	132	CBM32of AlyQ [Persicobacter sp. CCB-QB2],7D2A_A CBM32 of AlyQ in complex with 4,5-unsaturated mannuronic acid [Persicobacter sp. CCB-QB2]
5XNR_A	1.52e-15	1144	1261	13	132	TruncatedAlyQ with CBM32 and alginate lyase domains [Persicobacter sp. CCB-QB2]
5ZU6_A	1.83e-14	1114	1256	10	152	ACBM32 derived from alginate lyase B (AlyB-OU02) [Vibrio]
5ZU5_A	7.79e-13	1114	1256	10	152	Crystalstructure of a full length alginate lyase with CBM domain [Vibrio splendidus]
2FUQ_A	2.77e-08	420	560	19	156	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6XZB6	1.54e-07	420	560	44	181	Heparin and heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000235	0.999076	0.000171	0.000190	0.000169	0.000152

TMHMM  Annotations     

start	end
7	29