CAZyme Information: MGYG000004064_01820

Basic Information

• Species: UMGS755 sp900545185
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506; UMGS755; UMGS755 sp900545185
• CAZyme ID: MGYG000004064_01820
• CAZy Family: PL21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1599		179646.84	4.7302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004064	2605118	MAG	United Kingdom	Europe

• Gene Location: Start: 16566; End: 21365 Strand: -

Full Sequence      

MAACLKYKIALAFFAGMLLILLKYTCVSAETVVFEAETGIVNHNVFVTRQSAEASGGQYI
MSLTNNIGVTSAGGFASVETEYRFSVSKTARYNIHFRVRYDTGDSCYTVIDSTFYNTGLT
CGAGEWGWQKIGMIKLEAGEHVLRVYSREAYFCLDKVILTDRLAFVPEGKNPMPNEEGEE
LYASIPKEAPPKAHPRVWVREEDLPAIKANLHHPQNESVYNKLVALSEKQATGEMSSYSA
SLLEIAESKAFMYVLTKNRDVGREAVNIVVNYIRRVYISESATDAAMRAAGHVIYIGSCV
YDWCYDLFTPEERSMFIEAAEELATKNFETGYPVIQTLNGKTFTGHECENPVLKDLLAFS
IAVYDEKPSVYNNIVGLIYDNYIQTRNVWYTGEYNHQGSDITYGTYRVYFDACSLWMLDA
IGQSNIYIENFKNIPYQFIYMRRPDGNFLADGDNSILEYRNKLRYNDNALYFLVGNYYKD
ATIKHRYYKDRPERDYTSNSYIGVSPALYLICNDVSVELDNTKKLPLTRYFGSPIGVMTA
RTGWENGVGSPVALAVMKMYENYFGGHQHHEAGSFQFYYKGMLALDSGVYESLPYRDGQG
NYVAGSFWGSAHDVYYHKTTMAHNCLLVCDPNESDPWPVANGCQRHMPGDNGGPLSLASF
LNGDNKSAEVVGYDYGPDLNRPMYSYIEADLKYAYGSKVSAYTRSFVFLNLFDEEIPAAL
LVYDRVTSADPSFKKTWLLHSQEEPEINGNCVTIRRTEGELNGRLINKSLLPNQVKIQKI
GGEGYEYWNGKQNYPAKAYDEFNETGAWRVEISPQNVSSTDYFLNVMQVSDDDDTIVPAE
CSASDQGAYIGVFIKDRAVYIKKDAGRNYSDFSISCPGNGKRSYIVTNLREGLWKVYNIK
NEKIFEGRVNAQNGVLYFEADTGIYTLQRSGLAIPPKDFSIQKNAAQYDKIPVDIYFKDH
YDGRAYNDDGTVMVSIEDVCRLTKADVCNVSTESATVRNGTDELFFEVGSNTCSLNNTEI
PLDKAPTYYEGVLYVPVDALEHFIGFRADFDSLTNILYMDYKFLVDGANEKISNIKVNGI
ANIVGINCSDQQEGRGDRYNSADGNFQTAWRSQGSQWIEYRLDGLYDVSGIALAWDNGRF
REQNFSVTLMDDQGNIHEVYRGQSNGKTDQFENIMFEAPVTACSVRINADGNSQNSENTL
SEIKIFGEVHYNEEDDDDFPFGVLSFGYYDEKGRPVTAIVNSSVVYAKAYLERRGNSDCA
TVFAASYQNGKLYDIQRENIVFDKPKEKKEVSIGIAVPSGEGRPDIRTFFWDENGVLTPI
LPSADVKSNNPKIKQVSLDGVRIESFEPDSPACTAHVPASLGEQPQITVECEDLTTKVAA
EYKHDSIILTATAQSGISKTYTINLVREKEEVTDISVTYTTDHGKESESLSILGELHNPV
YSYDEQKNIMPFGPDFYNRVSRMYGDRSYFFYNSVPEELLGAHIIGLNMDSKIYNKHPYE
LTFTLNKSATIVFSSTNALANQHDYAGKKLEQPLLSLYAGNDWNTATNIYIPVEGGGSEY
YSTYYTAECIVPAGAASKTFTLYLHSSDLVGPQAFVLFK

Enzyme Prediction     

No EC number prediction in MGYG000004064_01820.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL21	554	632	9.9e-17	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	8.89e-11	968	1058	1	92	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam00754	F5_F8_type_C	7.41e-09	1086	1202	2	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam18675	HepII_C	1.79e-08	845	929	3	88	Heparinase II C-terminal domain. Heparinase II (HepII) is an 85-kDa dimeric enzyme that depolymerizes both heparin and heparan sulfate glycosaminoglycans. The protein is composed of three domains: an N-terminal alpha-helical domain, a central two-layered beta-sheet domain, and a C-terminal domain forming a two-layered beta-sheet. The C-terminal domain contains nine beta-strands packed together in a manner resembling a beta-barrel.
cd00057	FA58C	6.31e-05	1078	1195	7	134	Substituted updates: Jan 31, 2002
cd04080	CBM6_cellulase-like	9.88e-05	48	160	38	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20141.1	1.82e-155	186	1205	231	1225
QOU74174.1	7.48e-140	55	930	58	941
AYM77060.1	1.92e-138	55	930	58	941
QHW00380.1	7.53e-138	172	929	53	800
QDG70382.1	2.84e-137	55	930	78	961

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2FUQ_A	3.64e-133	190	929	19	747	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]
3E80_A	3.85e-133	190	929	21	749	Structureof Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_B Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_C Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus]
3E7J_A	9.51e-131	190	929	21	749	ChainA, Heparinase II protein [Pedobacter heparinus],3E7J_B Chain B, Heparinase II protein [Pedobacter heparinus]
2FUT_A	5.93e-128	190	929	20	748	ChainA, heparinase II protein [Pedobacter heparinus],2FUT_B Chain B, heparinase II protein [Pedobacter heparinus]
7D29_A	9.75e-17	1100	1216	26	139	CBM32of AlyQ [Persicobacter sp. CCB-QB2],7D2A_A CBM32 of AlyQ in complex with 4,5-unsaturated mannuronic acid [Persicobacter sp. CCB-QB2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6XZB6	4.01e-132	190	929	44	772	Heparin and heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000296	0.999113	0.000185	0.000141	0.000130	0.000132

TMHMM  Annotations     

start	end
12	34