CAZyme Information: MGYG000004066_01044

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004066_01044
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		30126.16	5.6161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004066	2039329	MAG	United Kingdom	Europe

• Gene Location: Start: 10234; End: 11025 Strand: -

Full Sequence      

MTTDMIKETTIPKTIHYCWFGGNPLGPDEMACIESWKKYLPGYEIKLWNESNWDVDCCDY
VREAYSAKKWAFVSDYARLDIISRYGGIYFDTDVEVVNAIDDILERGPFLGMETMGLDGG
LGTVNPGLGFASRPNDPLLDEVLAEYAGEHFIKSDGSYNDKTIVDRTTEIVNRYARIFPD
GFWHANGFTVYPVEYFNPKDYLTGSIVLTDNTRCIHHFSMSWFTPRRKYKHAVYSRLLSK
GVPERVANCVAVFFATVKFKSFH

Enzyme Prediction     

No EC number prediction in MGYG000004066_01044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	29	105	5.6e-22	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	3.59e-15	26	110	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	1.66e-13	1	147	72	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	2.29e-10	7	140	42	182	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.002	13	79	1	80	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIN94379.1	2.32e-80	11	250	2	234
QWT54350.1	5.44e-79	8	240	8	244
AFQ45980.1	1.74e-77	11	250	2	240
QUT53709.1	2.51e-75	11	229	2	220
QIA43512.1	9.56e-74	11	240	6	229

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004066_01044.