CAZyme Information: MGYG000004067_00116

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274
• CAZyme ID: MGYG000004067_00116
• CAZy Family: CBM77
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825		90149.34	4.0937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004067	1958521	MAG	United Kingdom	Europe

• Gene Location: Start: 34645; End: 37122 Strand: +

Full Sequence      

MKKIISRAVSALLCAVISLNPLSVYGAVQISVNTVTTVGSSQTIEQLTANDTYKVRDAIY
SLTDSSVNRAASEHFQIIWGNSDSTGLVNDELIRGNLINLENIRTFYMEDLGMKDIGISQ
NSSITGKYKTNIYISNTGLSSFDDDWAYMSTDADSFAYLFLAPGAMRVDEPSWVVPHELA
HAFTYHQGGIIPYAWYESTANWFRDQYLGSQYYAYGGNTYGPTSDFFAPYMINSCYYVPH
MLNWYDTWPIFLYISENPDNIDGLGMELMHKIFENTQSDETMYATIERLSGVDIKTILGG
MARRMATLDFSRQEHYLKHLNEETLTVEGNYEKIYSALGTPDSQGYQTVAEDKFPMQTGF
NIIPLEADLTKDILKAEFINTSTASGADFRVSLVTKTADNTTRYSQMYDSGTGGIYLQGD
EVQAYLVVCATPDNLKNYEINWDSSAEDTDTRYTYKVKITSEDIPVEESSTEATTEYTEP
TTSVPVVTGERSHNFEDNGTTSDYFTITGNTSNSKGSCTYSDRTYNTCLKMESATSISFN
ASGQGTLTLVFGGNTAFSGKKVKVDGAAYTIDSTGVLNVSLSAGSHTITKGDAINLYYIS
YSEEGTAVEGTTQPTTQSTTEAVTESATESSTLPTDSPVSGDVNLDGKVDDTDSTLVLKH
IGGSLLITDETALVNADYDCNGVIDITDSILILQNKTPEEQIPVTTITTPLEAGTYDAST
IISDNARFVVNGSTSATQIKIDENGYVEFLVNDGATVTVSFKCGSSNTTKSAYITLYDQT
SQTVYGGSSEFSTLTADLDGGYYRIFAGQTGGTTAQIVQITVNYN

Enzyme Prediction     

No EC number prediction in MGYG000004067_00116.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM77	492	597	4.8e-35	0.9805825242718447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18283	CBM77	1.42e-37	489	599	1	108	Carbohydrate binding module 77. This domain is the non-catalytic carbohydrate binding module 77 (CBM77) present in Ruminococcus flavefaciens. CBMs fulfil a critical targeting function in plant cell wall depolymerisation. In CBM77, a cluster of conserved basic residues (Lys1092, Lys1107 and Lys1162) confer calcium-independent recognition of homogalacturonan.
cd14256	Dockerin_I	8.03e-11	641	694	2	54	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd14254	Dockerin_II	8.53e-07	641	695	1	52	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
pfam00404	Dockerin_1	3.32e-06	641	696	1	54	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14253	Dockerin	6.66e-04	641	695	1	54	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH67539.1	7.74e-149	43	463	35	450
CDM68951.1	2.02e-97	48	461	44	449
ACR71161.1	3.12e-24	489	611	779	902
QQY82326.1	8.80e-21	442	609	600	756
AIQ38798.1	9.45e-21	488	599	603	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FU5_A	4.89e-25	487	602	4	114	Thecomplexity of the Ruminococcus flavefaciens cellulosome reflects an expansion in glycan recognition [Ruminococcus flavefaciens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000259	0.999102	0.000192	0.000154	0.000146	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004067_00116.