CAZyme Information: MGYG000004067_01608

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274
• CAZyme ID: MGYG000004067_01608
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000004067_115|CGC1	61780.94	4.3585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004067	1958521	MAG	United Kingdom	Europe

• Gene Location: Start: 3015; End: 4670 Strand: -

Full Sequence      

MKKNAMRFASVTLVSMLLSNSNIMANTANTEDILSQEAQEVYNSVEKVETPDISEINNVS
IYIDGKKFNSDNALLIDKNSNRTFLPCRKVSELLSAVVDYNVQYQMATIKKGEDIIEVFI
SKPQGVINGEAGYIDSENKNVAPLLYNNVTYLPIRYLAEALNFEVKWVYDNDESKIYIET
KADNEKLNEAPFSVADNLFDESKTNIGLEKIEGAETYTIFSAGEGTDHYVNGVFMTEFKG
KIYCQWQSSAVDEDAEDTWVAYSVSDDGVNWSEPKVLVPTIENGYCSSGGWYVNGDTIVS
YVNVWHNETSPRGGFAYYIESKDGVNWSEMKPVLMKDGSAMNGIIEQDPHTLESGRIVCA
AHFQPGLFANPIYTDDKSGVKGWVRAEYTNMETDGETSREMEPSLFVNSDNDIIMIFRDQ
DSTFYKLASISKDQGETWSNTVLTNMPDSRSKQSAGNLPDSTAYLVGNSVTNKLRIPLTI
TLSKDGKFFDTAYVLRTQDDIPELKYEGKAKRVGYHYPKSVVIGDYLYVSYATNKEHVDF
TRIPLDAISLN

Enzyme Prediction     

No EC number prediction in MGYG000004067_01608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	249	495	2e-17	0.7573099415204678

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	2.09e-55	240	529	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	8.44e-21	257	486	46	289	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam07833	Cu_amine_oxidN1	8.10e-20	81	178	3	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07833	Cu_amine_oxidN1	2.49e-04	146	185	1	37	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
COG4692	COG4692	0.001	395	544	235	372	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79596.1	4.00e-113	194	545	347	701
QDU80203.1	1.38e-19	208	549	60	397
QNN22017.1	2.63e-16	217	548	237	566
QDU98432.1	1.78e-14	234	548	91	409
ADY61523.1	1.83e-13	185	534	227	580

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000330	0.998861	0.000271	0.000182	0.000168	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004067_01608.