CAZyme Information: MGYG000004072_00167

Basic Information

• Species: UMGS1540 sp900552775
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1540; UMGS1540 sp900552775
• CAZyme ID: MGYG000004072_00167
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1442		163725.48	4.5274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004072	2483861	MAG	United Kingdom	Europe

• Gene Location: Start: 224550; End: 228878 Strand: +

Full Sequence      

MERGFFLKLLKNIATLFLTVLISLNMCGTACADDSLDVSLSYNDYPTYDVPADLNVLADG
YYIEEYAQNEKGLLLLAKSRRAEYKVNASLKETFVISFELVTCGKGIDGFISLSDGTRNF
TPIKFVKTDLSLRLFDNNKIGFYRQSGKTRIDVSVDTSSKSYDVYINGTKTVSSYYSNRM
SLDSLSYVTFYFEPYDDAENGIILDNINCHSGILPKSNYPVAQFNMQKNEKPTFEEKQIG
NIVITNEGFEEESLSVMTEDYGHAFKLIHDENDNGCLSVNKIAESRALFASSVNTGEMDR
LVIEYKVKIFDENSSFDLCQFKSEKGNWSSNVQVRGSVVKGNKGEKSYKLPLYVWTKLSF
AFSVSGKFFDFYVDDKLIEKGIEWANPFPEAISEIRFSLGATKGYVTPANLFVDDYRVYE
GKIPRTISADQKIEFPPYTILPSDNAEDALMKDRVGLHLKSGVMYSKGQRSELDVPPYIK
NDRTMIPVRAVSEAFDLDVKYDDINKSVSVNDNTVLIIGKNEMTVDGKTITLDCAPEIKD
GRTFLPLRDLCEKALGKNVYFDNSVVNGGMIIIGNTEFTPPGDLESLQRLNDYLFFLRPS
SEWLTEKLEEKNYKNIHPRILINNNDVTRLKTEIKENSIKSEWFKELLEACETFKTVPIP
EYGTYDGTRMSREPVAEALDMALVYLITGDISWVDAAWPKIEAVCSWKDWNPDREFLNCA
DFSFLVATCYDWMYDALSDEQKKIMEEALYDKCLIEAKKWWYGIKGPKDKWQMAKANWNP
VCNSGISIAALSMLDVYPEEAGEIISLCTRGLEYVSQRFAPDGSWFEGPAYWEFVFKFLA
RYLDAFEKVFGTTFAIDKMEGLDKAATSILYLQSSYGSFNFSDADVEVIYPEALYYLSNH
YNNPSATAVNLSKNKRKTTSIYNTPFALIWYNTDIDDSNDSITLPYDATFSGDGAFAVMR
DSWIDDYGTYVGIKAGRAVYNHSHLDLGSFIFETEGERWAIDLGKDNYNLPDYWDSNEKR
WKFYRLRAEGHNTIVINPDSTGADMNLKAVAEIESQKSSEKGAITVVNMTDALKKDVLSA
RRGFFLTDDRKSLVVRDEVTLLAPTDEFYWTMHTKATEALIDGNRVIISSAGKKMLLEFA
CNADFDISFEDAVARPGMPTVANENQNVGVKKIVLKVHGKKTVNLTAKLSPLDVMTTPIS
DYDISIDDWNLPEGSIQEEKYVPDEIYYGNRKLEGFNEVNRNIVVNYVEGISEIQKISAK
SHNYKIEITEPENFEDYGIIKVYGEDENYTQYVVSFRKIPAPTKFEGFESVAIRDVSASD
VPQPLNNEYNVLDGNLETRWSAANDLNNYVWLQFELDKESELDTLMLATYLGDKRQTKFK
VEVSENGTDFKEVFDGQTGGQTLDFEEFTFEKCIAKYVRIKFFGTTEGSWNSPTDVVFAN
KK

Enzyme Prediction     

No EC number prediction in MGYG000004072_00167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	968	1141	1.5e-53	0.9664804469273743
CBM32	1322	1426	2.1e-16	0.7903225806451613

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	1.21e-22	480	573	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam00754	F5_F8_type_C	3.02e-14	1316	1430	2	120	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07833	Cu_amine_oxidN1	6.28e-12	452	510	35	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07940	Hepar_II_III	2.23e-10	943	1157	1	208	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
cd00057	FA58C	4.25e-05	1307	1420	4	126	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH30172.1	5.03e-141	600	1442	56	897
AZS17848.1	6.53e-116	289	1436	106	1274
QNK58643.1	5.27e-107	596	1436	773	1606
ALS27107.1	1.89e-104	596	1442	678	1514
ACX64738.1	4.82e-101	591	1436	453	1294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D29_A	2.62e-15	1330	1436	26	129	CBM32of AlyQ [Persicobacter sp. CCB-QB2],7D2A_A CBM32 of AlyQ in complex with 4,5-unsaturated mannuronic acid [Persicobacter sp. CCB-QB2]
5XNR_A	1.32e-13	1330	1436	26	129	TruncatedAlyQ with CBM32 and alginate lyase domains [Persicobacter sp. CCB-QB2]
5ZU6_A	9.81e-12	1331	1440	50	158	ACBM32 derived from alginate lyase B (AlyB-OU02) [Vibrio]
5ZU5_A	2.35e-10	1331	1440	50	158	Crystalstructure of a full length alginate lyase with CBM domain [Vibrio splendidus]
6JP4_A	5.02e-07	614	1037	20	454	Crystalstructure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_B Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_C Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_D Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000825	0.506871	0.491564	0.000321	0.000216	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004072_00167.