CAZyme Information: MGYG000004072_00746

Basic Information

• Species: UMGS1540 sp900552775
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1540; UMGS1540 sp900552775
• CAZyme ID: MGYG000004072_00746
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1021	MGYG000004072_4|CGC1	114454.7	4.6312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004072	2483861	MAG	United Kingdom	Europe

• Gene Location: Start: 67235; End: 70300 Strand: -

Full Sequence      

MKKLTAILVSLVISASLLPARAETTPGHKLEMFMGNAAAFYIGQPKMYTGGEVKYVDSEN
TAVLPYIKDGRTLVPLRAAGESIGAEISYNEIERSVTAVYNGETAVFPIGQNEFTLGGKE
IPLDVAPEIRESRTFVPIRAISEGFGKKVSYDKCGLVVIADRENFFDLEKDLDLFRELTG
KLCFHAPSGIEAVNKIKENFPDNKHPRLYADDDKIEVLRRRVKTDASVSKWFKGIRDYAD
TYIGTDPVVYDIYDGIRLLNISRKARSIMQELAFCYQMTGETKYADRCIKEMNAVCEFPD
WNPSHFLDTAEMTEGLAFAYDWLYNYITPDFREKVKTAIIEMGLNQGVQDYRNKPEDRKR
TYRWAQSSVADNWNIVCNSGLIQGAMAVCEDAPELAAEIFESGMKLLEKAVLMYGPDGAW
YEGPGYWQYATEYFIDLCSCLDSVFSDTFGYLNAPGVSQTGYYITAITGPCGNFNFHDSA
IPAVNAPELFFLADKLSDSALSALRTEQMKNRNTKGSIRDILYYNPELSGDSALMKKDYY
FRDTEVAALRSDWNDYNAVFLGVHAGKTDVYHGHMDAGSFVLDGFGTRYACDLGADDYNI
DDSVWNLYRYRAEGHNTLVINPSKDGGQKIEGSAKIDRFEYDDNDSLAVMDLTDMYDAKS
VKRGFKLIDNRSAVIIQDEIKTDTPSDIWWFMHSAQGIEVSEDKKSATIKGEYRNLKISL
LQDTPGEFSVMEAAPMETSPQNDSQNKNLKYRKLAFCAKNVTDLTIPMLLRFELPIEGAE
EGIKPGVTKLDSWTLDNAETPKKPKLTSILADGREIEGFESDRFVYAYRGPSENEKAPEI
TARGQGEISVVTTGSVPGYAVVSVTENGETQHYVIKIEREILKKAPSDVLNFEIKGVEAS
DVPQPENNAENTIDENLATRWSAYGNAHIVYDLGEVKTIKYVGLAVYQDKSNDGRRQYFD
ISVSEDGENYRHIFTGETTGTTLEEEIFPIGEAKGRYVKIYCKGSSMGNWNSITECNIYG
K

Enzyme Prediction     

No EC number prediction in MGYG000004072_00746.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	557	722	3.2e-44	0.9720670391061452
CBM32	899	1016	1.9e-19	0.9112903225806451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	1.88e-28	68	152	1	85	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam00754	F5_F8_type_C	1.59e-12	897	1015	2	126	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07940	Hepar_II_III	2.53e-09	541	709	9	179	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam07833	Cu_amine_oxidN1	8.00e-09	40	97	40	92	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam16332	DUF4962	4.72e-07	269	437	215	373	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS27107.1	2.92e-162	184	1020	678	1512
QUH30172.1	5.10e-151	188	1019	56	893
SDS98549.1	8.01e-145	205	1021	52	860
QNK58643.1	9.84e-142	184	1020	773	1610
QNK56587.1	1.82e-140	203	1021	219	1028

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D29_A	2.38e-17	890	1019	7	132	CBM32of AlyQ [Persicobacter sp. CCB-QB2],7D2A_A CBM32 of AlyQ in complex with 4,5-unsaturated mannuronic acid [Persicobacter sp. CCB-QB2]
5XNR_A	1.54e-15	890	1019	7	132	TruncatedAlyQ with CBM32 and alginate lyase domains [Persicobacter sp. CCB-QB2]
3A0O_A	3.73e-08	205	694	139	661	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	1.11e-07	205	694	139	661	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999000	0.000231	0.000186	0.000180	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004072_00746.