CAZyme Information: MGYG000004072_00804

Basic Information

• Species: UMGS1540 sp900552775
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1540; UMGS1540 sp900552775
• CAZyme ID: MGYG000004072_00804
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	MGYG000004072_4|CGC3	51780.06	4.8317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004072	2483861	MAG	United Kingdom	Europe

• Gene Location: Start: 146040; End: 147434 Strand: +

Full Sequence      

MKVEKNSASEIKIAYIGGGSRGWAWNLMSDLAQEKSLSGEVCLYDIDLEAAKANEIIGNK
IREVHKDADNWYYTTAPTLCEALTGANFIIISILPGTFDEMRSDVHAPEEFGIYQSVGDT
TGPGGIIRALRTVPMYEVIAAAIRDYAPDAWVINYTNPMAMCVRTLYRVFPKIKAFGCCH
EVFGTQKFLAKVMQKALGCEEIDRSEIKTNVIGTNHFTWLTSAHFRNHDIFPYYEKFCEE
YGEKGFTEGNDTNWLNRVFQCAQKVKMDLFKKYGYIAAAGDRHLAEFCPGTWYLDNPETV
KSWGFDLTSVDFRLELLADRMEKSRKMVSGEQEFELNPSGEEGVIQIKALLGLGDLVTNV
NLPNYGQIPNLPLGAVVETNASFTADSVTPVFAGAMPQSVLALSSDPIICQEMTVEAALT
RNLDLAFSAFVKDPQVTKISRTDSKKLFDKMIANTADYLTDYKI

Enzyme Prediction     

No EC number prediction in MGYG000004072_00804.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	192	1.3e-56	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	2.78e-153	11	452	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.68e-105	11	463	4	440	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	2.79e-76	12	463	3	431	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	1.44e-58	12	193	1	181	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	1.34e-48	11	459	1	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ85649.1	2.52e-201	1	459	1	458
AFK85236.1	2.55e-199	1	464	1	463
SNX53414.1	1.36e-198	1	464	1	463
ADL69889.1	8.42e-198	1	464	1	463
QEH67112.1	1.11e-197	1	459	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	9.91e-155	7	449	2	433	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	4.91e-23	11	462	5	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	5.90e-21	11	462	8	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	7.50e-18	43	431	62	435	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6KCX_A	1.05e-16	11	378	13	393	Crystalstructure of citrate complex of alpha-glucuronidase (TM0752)from Thermotoga maritima [Thermotoga maritima MSB8],7CTD_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTL_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	5.10e-200	1	464	1	463	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	2.68e-187	1	459	1	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	7.03e-181	1	459	1	460	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	1.36e-158	6	452	5	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	3.71e-53	12	463	3	432	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004072_00804.