CAZyme Information: MGYG000004075_02172

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000004075_02172
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		83593.21	4.9707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004075	2841804	MAG	United Kingdom	Europe

• Gene Location: Start: 17322; End: 19568 Strand: +

Full Sequence      

MNFPQTFIRATETFGTRQNPVPAPYLRRSFTLDKPVREARLLICGLGFYTLSVNGKDITK
GPLAPYISNPTDILYYDCYDAAPSLTQGENVIGVCLGNGFMNALDAGVWDFEKASWRSAP
QVALSLRIVDEDGAERFIDTTEGFVTAPSPIRFDDLRFGETYDAREELPGWDTPGFDASG
WTPALRAPHPGGECRLCEAEPIIVSQELRPVDIVQEPDGYRYDFGVNTAGLFRLTIQGAP
GQEIELECAELLDNGRLSHRNIRFNDNYQIQIDHYICRGGDTETHVPFFTYHGFRYILVR
GITPEQATPELLTCLVMHSGVEERGNFSCSDETVNALQAAARRSDLANLFYFPTDCPHRE
KNGWTGDAALSAEHMLLNLGVETSLREWLRNVAKAQNSEGALPGIVPTGGWGFAWGNGPA
WDCVSFVLPYYVYLYRGDRQILRENAPTMLRYLHYLSTKIRPDGLVAYGLGDWCPVGRNP
EDYKAPLEVTDSLISMDSCRKAAFIFHVLGLPEQQRFADGLADRLRRAIRERLIDFSTMT
VAGRCQSSQCMALYYGAFEPGERAAAFSRLLDFIDEAGGHMDVGAIAARTLFSVLSDFGR
SDLAFEMITRPDFPSYGNLIARGATSLWETFFDEGKKPDSLNHHFWGDISGWFIQRLAGI
RFNPHRDNWQEADIAPDFVPQLTHAEGFHIAPAGRIASAWKREGNAIVLTVEAPASMTGE
IRLTDGWLFDDGLTFRPLSSGTFRLHKR

Enzyme Prediction     

No EC number prediction in MGYG000004075_02172.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	216	723	1.4e-127	0.9900793650793651
CBM67	15	189	9.1e-32	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.63e-80	322	657	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.69e-41	34	206	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.15e-20	217	318	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.51e-10	659	726	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	1.67e-154	18	716	138	833
ANI90810.1	2.87e-147	15	721	140	848
AGA80189.1	3.50e-145	22	732	145	857
AWW29280.1	7.29e-145	15	723	145	855
AYD48149.1	1.17e-144	22	721	155	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.93e-102	14	723	167	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.12e-78	23	721	302	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.53e-61	9	704	121	820	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	8.58e-90	23	742	184	928	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.01e-77	23	721	302	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.28e-76	15	723	165	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	8.04e-76	25	720	172	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004075_02172.