CAZyme Information: MGYG000004082_00166

Basic Information

• Species: AM51-8 sp900761925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp900761925
• CAZyme ID: MGYG000004082_00166
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803	MGYG000004082_2|CGC2	88291.56	4.8862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004082	2757417	MAG	United Kingdom	Europe

• Gene Location: Start: 74672; End: 77083 Strand: +

Full Sequence      

MKRESFNDGWEFGKQGEEKRKVFLPHDAMQLEQRSADAKGESACAYFPGAVYEYEKTLEV
PADWEGKRVLLQFEGVYQKSRVYVNDVEAGGCVYGYVPFFVSLDAYLKPGQENVIRVVAD
NSEQPNSRWYTGGGIYRSVWLWVGAPESIAPEGLKVSTVSVDEPAVAVDVELLGEEKDDL
TVEVEISCQGQTVARGEGFHARIAVPGAKLWSAETPELYRCVARVKRGEELVDEAETVFG
IRQITCSSRGLFVNGKETLLRGGCVHHDNGIVGSASYAESEWRRVKMLKDAGYNAIRSAH
NPASAAMLEACDALGMYVMDESWDMWYRHKSAKDYATEFMDCYEKDLRAMVERDYNHPSV
ILYSIGNEVSEPAEKKGVDLAKEMVEFLHELDASRPVTGGMNLMIISRSSKGNDIYKEEG
GRNDDGAAKTQGMNSTIFNMMTSMVGTGMNKGANGKKVDEVTTPVLDALDIAGYNYASGR
YPLEGKAHPNRVIFGSETFPQDIAKNWKMVKEYPYLVGDFMWTAWDYLGETGIGAWAYTP
DGKGFDKPYPWLLADVGALDILGDPNGELFLAQAAWDLLDQPRIAVQPANHPGVKPAKAV
WRGTNALPSWSWKDCDGNRTVVEVYTGGAAVELFLNGKKLGRKKVKECKASFKVKYAPGE
LRAVAYDASGKVVGESTLTSASGATELRLTRETPVLDPKFACPAELRDPETGENASVIYV
DVELTGENGQRQMNDDRNLKCQVEGGRLLGFGSANPRTEQRYPDGIFAAYYGKALAAVLV
AKGRKATVKVSGESLAAELEVEG

Enzyme Prediction     

No EC number prediction in MGYG000004082_00166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	565	4.2e-105	0.5944148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.03e-62	49	398	83	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	9.77e-42	49	398	65	446	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.87e-29	54	397	113	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.61e-27	54	368	124	462	beta-galactosidase.
pfam16355	DUF4982	1.88e-17	617	675	1	61	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE97750.1	1.28e-317	1	795	1	775
AFN84582.1	2.08e-288	1	778	1	744
AHF23998.1	3.39e-253	1	792	23	817
QTL78998.1	1.51e-233	22	793	29	790
CBK92219.1	4.02e-215	1	778	1	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.46e-118	1	762	5	734	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	2.21e-118	1	762	5	734	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	8.54e-94	1	778	1	774	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	3.69e-92	5	794	29	808	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	1.08e-90	2	798	8	801	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	3.50e-97	3	795	44	851	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.10e-66	24	688	80	715	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	2.26e-34	54	644	107	676	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P26257	4.95e-28	22	416	33	429	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
P77989	5.09e-27	4	416	17	428	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004082_00166.