CAZyme Information: MGYG000004082_01466

Basic Information

• Species: AM51-8 sp900761925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp900761925
• CAZyme ID: MGYG000004082_01466
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000004082_45|CGC2	89273.83	5.4533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004082	2757417	MAG	United Kingdom	Europe

• Gene Location: Start: 16594; End: 19011 Strand: +

Full Sequence      

MRRIDCNGNWSVEKEGTGENRAVHLPHDGMIYEKRDKDAAPAGACAYFHEGKYIYRKKIM
VPAEWTDRAVILECEGVYQNASVLVNGEELNRWPYGYTNFYTDLTGHLRPGEENEIVIIA
DNSKAPNSRWYSGSGIYRPVWLYVGPEDGILPEGVKVTVVDRDTVRVDVEQRGEEAGEEM
LVDILDADGQTVASARGCHTTIQIPDAKLWDADHPCLYRCRARIRREGKLWDESSVSFGL
RQIAWGSEGFSVNGQTVLLRGGCIHHDNGVLGACDFRDAEWRRVRIMKEAGFNAIRSAHN
PISKDMLEACDALGMYVMDETFDMWLVKKNAYDYGGDTFREWWKRDVDAMIAKDYNHPSV
VMYSVGNEISELGTAEGQELCRKLADEVRRQDGTRAVTCGINLMLASMAAKGKGIYGTDK
EGKENKNGSSTMDSVPTSTMFNVMMNRMGGIIDRMASTSGADKAADAIAPCLDIAGYNYA
TSRYRKEAKKHPDRVIVGSETLPKSLYRNWELVKALPNLAGDFMWTSWDYLGEAGIGTVR
YTDKKTKQDTDPGLIISGGPGVIDICGKKRPEVYWGELIWGLRKEPAIGVDPVIHAKDFR
GASMWRDTDAVESWSWDGCEGSRTGVVVYADADTVQLLVNGRSVGRKKVKECKALFSKVT
YEPGEIEAIALDAAGRETGRARLISATGATKLKLSPERTLLRANGQDLCFLDIDLVGENG
VTRSSVDQKLTVEVTGAGTLQAFGSARPHMAEDFVSQSHTTYYGKALAVIRAGYEPGEIR
VKVSGKDMEEEITLRVTADDSWEKM

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	545	1.8e-99	0.5930851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.30e-64	1	395	10	434	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.44e-50	49	406	63	453	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	5.85e-31	692	793	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	1.41e-28	54	397	112	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.22e-19	103	368	173	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50826.1	0.0	1	796	1	794
CBK92219.1	0.0	1	790	1	784
AEE97750.1	1.36e-250	1	799	1	785
AFN84582.1	8.49e-242	1	773	1	747
AHF23998.1	2.00e-211	1	785	23	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RSK_A	1.47e-130	13	786	25	766	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6B6L_A	2.67e-130	13	786	25	766	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
4YPJ_A	1.43e-99	2	784	8	794	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	8.76e-96	1	798	1	803	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	7.21e-87	21	788	55	811	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	4.98e-87	3	800	44	850	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.52e-64	2	781	45	804	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.41e-30	5	369	55	431	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P05804	6.81e-28	1	405	12	448	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
Q56307	1.78e-25	54	397	113	464	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004082_01466.