CAZyme Information: MGYG000004082_02289

Basic Information

• Species: AM51-8 sp900761925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp900761925
• CAZyme ID: MGYG000004082_02289
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38052.75	4.5239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004082	2757417	MAG	United Kingdom	Europe

• Gene Location: Start: 4220; End: 5251 Strand: -

Full Sequence      

MSSREKADTADVDCHEIYSDFPVEETEEEKRILDQMTGEQMAVLVCGTPASGSFQSDIGT
AAATVPGAAGETTSDYIGAPWHLVNMVLADGPAPRKEGTDYYQYCTRIPSGTLLAQTFDL
DLMEQMGRLVGEEMEQFHITLWLAPGMNIHRNPLCGRNFEYYSEDPCLTGKMAAAITRGV
QSCPGVGTTIKHFVCNNQEDNRQHRDSVVSERALREIYLKGFEIAVKESAPLAVMRSYNL
LNGVHTANSYDLLTNVLRREWGFQGMVMTDWNTTGKGGSAADLCIRAGNDLVMPGTPRDV
EEIVSGLQNPSEDSLQYRELRACAARIVRMILQSNRYEDEKQE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	98	294	3.6e-66	0.9074074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.22e-56	106	341	81	322	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.82e-32	106	298	86	288	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	5.65e-20	106	293	118	319	beta-glucosidase BglX.
PLN03080	PLN03080	1.48e-14	106	270	112	297	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ93533.1	2.24e-118	17	339	487	840
ANU75960.1	2.24e-118	17	339	487	840
ASU28771.1	2.24e-118	17	339	487	840
QJU13871.1	3.15e-118	17	339	487	840
QBE97876.1	3.83e-116	17	339	487	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	9.88e-76	27	332	2	305	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.44e-74	27	332	2	305	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WUG_A	1.03e-61	35	332	523	820	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
7MS2_A	2.28e-47	83	294	37	251	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	8.30e-46	88	298	43	249	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	5.95e-56	35	293	551	788	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	2.55e-53	72	293	496	725	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
Q5BFG8	1.33e-48	109	305	70	263	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
Q5AV15	2.29e-47	86	298	70	278	Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglJ PE=3 SV=1
F6C6C1	9.19e-47	78	309	24	266	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004082_02289.