CAZyme Information: MGYG000004082_02337

Basic Information

• Species: AM51-8 sp900761925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp900761925
• CAZyme ID: MGYG000004082_02337
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		89331.72	5.0748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004082	2757417	MAG	United Kingdom	Europe

• Gene Location: Start: 1833; End: 4283 Strand: -

Full Sequence      

MKESRKQKKRYMDTALPPKERAKALLEELSLEEKVAQLNCVCIFSEEGTDPEKIRGLMSC
GIGAVSTLELRRMKTLEEAADWQIRVQRAAMDSSPHRIPAMFHMEGLCGAFLQDATSFPA
GIGRGASWDPGLEEEIGRVVSRQEKACGITHIFAPVLDISRDSRMGRQGETYGEDPTLAA
ALGVAYTKGIQTEETAGRKADAVAKHFLAFHNSIGGIHGADSQTPERLLWEIYGKPFQAA
ISLADLRGIMPCYCSLNGEPVSLSKHLLTDLLREEMGFEGLCVSDYGAIGNAFSYQHVGE
SPEETGVMALSAGMDMELPNPAGFGEAFAEMFRRGEADEAALDRAVLRVLTEKFSMGLFE
HPFALVGKELCREFYDERDREISLRSAKESLVLLKNDGVLPLRADVKKIALIGPHADSPR
KYFGGYTHMCMMESTLAIANSIAGVSGNENITGEKIVTVPGTNIQSDEGPEFDEILKRQK
PQCKSILEQLRIRYPEAQIRYARGYPVAGNSREGFAEALEIARDADVILLTLGGKHGTCS
MATMGEGVDASNINLPPCQDAFLEEAFRLGKPMVGIHFDGRPISSDAADRFLNAIVEAWS
PAEMGAEAVVGALAGDDNPGGKLPVTVAYHAGQIPIYYNHPGNSCWHQSGSIGFADYVDL
PHTPRYVFGYGLSYTRFSYDDLRISPGNAEPFGEVTISCLVTNIGDRPGDEVVQLYLKDV
QASMIRPVKELAGFARISLLPGETKKIVFSVKPSQLAFLDRNMEWKIEKGRIEVEIGSSS
EDIRLKGAFDIGENACVEVRERGFFAKTQILTKNTI

Enzyme Prediction     

No EC number prediction in MGYG000004082_02337.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	93	319	7.4e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.36e-134	34	791	50	764	beta-glucosidase BglX.
COG1472	BglX	3.72e-74	83	427	45	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.45e-59	34	351	5	315	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.45e-56	115	756	111	747	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	9.33e-41	391	674	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV22852.1	0.0	7	809	4	815
CBL11432.1	0.0	7	809	4	815
QRT50982.1	0.0	7	809	4	815
AJG98232.1	0.0	11	807	8	802
AIQ31530.1	0.0	8	806	4	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	2.65e-102	11	784	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	2.90e-102	24	784	16	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.53e-101	24	784	16	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	5.08e-95	24	780	9	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.67e-94	24	780	9	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	5.03e-108	98	786	65	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	6.97e-100	25	791	41	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.94e-98	25	791	41	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.30e-95	7	784	25	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.32e-75	26	783	43	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004082_02337.