CAZyme Information: MGYG000004085_00588

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UMGS1253; UMGS1253
• CAZyme ID: MGYG000004085_00588
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764		85992.46	4.7708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004085	2144710	MAG	United Kingdom	Europe

• Gene Location: Start: 625409; End: 627703 Strand: +

Full Sequence      

MQLSNRFVRATDKVCTFQEHVNAPCFRKSFRLDGAVERAEMTICGLGFYELYINGKNITK
GPLAPYISNPDDVLYYDRYDVAPYLQEGENVIGVVLGNGFFNPFGGAIWDFEKAVWIGPL
RFALWFEAECGGKTVTFEADDGFKAHDSAILFDEYRMGTHYDARLEMPGWSAPGFDDSEW
TGALHAEQPRGEAVLCPADPIVVTGERKPVSITKCSRGYIYDFGANLAGVCRLTVKGKPG
QKISLWHSELLKDGELDISSIIFDRPGFRDYYFEYAQKDVYICKGEGEECFVPPFTYHGF
RYVLVEGIDEAQATESLLTYLVMNSGLKERGGFSCSDETVNLLQLFARRSDLANFYYFPT
DCPHREKNGWTGDASMSAEHMLLNLHAENSLREWMRNVRKAQRIDGALPGIVPTSGWGFA
WGNGPAWDSVCVNIPYYVYKYTGDDAILYENADMIFRYLNYITTRMDERGLIAIGLGDWC
QPIRRQLPEGKEPTDNDLYSSPLEFTDSAIVLDMCKKAAFIFERIGRHPQKEFAQKLHEA
LLTSIRTYLIDTDAVMAIGNCQTSQALAIEFDIFTEEEKPKAYENLLKIIHDGGDFMDVG
MIGARYLFHVLAKGGDADLALKMITRPEWPSYGDWIARGATALWEDFVRPEGKQNSKNHH
FFGDISAWFIRYIAGLKPNPSTCNADEVEVSPCFVTALEHAEAHFDAPKGRMEVCWKRES
DKIVLSVVLPEGGFGVIRLPEGYCFADGEADCLAVSGDYVVTKK

Enzyme Prediction     

No EC number prediction in MGYG000004085_00588.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	217	737	7.5e-124	0.9821428571428571
CBM67	19	187	3.8e-31	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.73e-72	328	673	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.10e-40	34	204	1	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.84e-25	219	322	8	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.02e-09	687	742	11	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	3.89e-150	18	743	138	844
AVM44981.1	1.06e-143	23	742	50	744
QNK63660.1	1.42e-140	23	749	162	869
QGA24212.1	5.10e-140	18	748	151	869
AGA80189.1	6.03e-140	23	750	146	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.45e-105	23	764	176	926	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.56e-73	26	716	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	2.16e-72	27	743	306	998	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.56e-89	23	730	184	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	2.10e-79	27	740	178	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.98e-74	27	730	174	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.05e-71	27	743	306	998	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004085_00588.