CAZyme Information: MGYG000004085_01494

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UMGS1253; UMGS1253
• CAZyme ID: MGYG000004085_01494
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1385		154216.75	4.2468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004085	2144710	MAG	United Kingdom	Europe

• Gene Location: Start: 96948; End: 101105 Strand: +

Full Sequence      

MKKSFAKVVSSVLAIAMLFTCLPFGAGVLAAGDGAENVFETEDGLLDIEAEELAYDEERI
DELKSDLYSGGAALKPLIEDKNQPAQDAAASVEVQFTADKDGTYYIWMRHTASVERMNGG
NLWLSLNNGVYNFTNLKAEAEAPAWFVLGKVTLKAGETGSVRIIPRQIVSIGYDRFIISC
DETYVPTDKELNIKASAQATSYPIPTPTPPPEAIEPNADGTYDIIDFDDEESVKKYGFTA
SKENKEDTKYTAEWYPNNVRDLHIKDVNNLSNFNMLKIRVYGNSKVPVTFLLQLMSNDPD
TEGDDYYGKTITVDQDGWQEFVIPFSEIGATRSPLGFDQITAISLRTKGWDIENPEGSVL
YFDKFQLVRDEEIAREEEILKQEEEAQATSDPTDLSKVEDAVCLFLGNGHAYSKQQRVAI
DPDNPDVVPFTENDRTLVPIRFISEQLGAEVAYDEATEQVSVKKDGIEITMTIGSNTVYK
NGQEVVLDVAANTYNDRTFVPLRACAELLNKQVYWHDMGLIVISDYENIYDDDKDLGILY
TIIQNIIFDRPTGEQMMADLQATNPNDAHPRLLANAQQIAEIKERAKTDTVLQSWIDSIE
KSSQGILEQPTVEFIPELGYDNGMLTVARTAKEKLYKMAFLYQFTDDDKYAERAWKELEE
ICSWPDWHPGHFLDTGELSYGVALAYDWCYDYFTPEQRKTIEDALHQNAVMDGIGAYNGT
TDKMDSGTHNRSGWTKATTNWNAVCNAGLLMASAAIANVYPEDCTTLLGHIIKSVELGVK
DYAPDGGYAEGPGYWEYGTTYLVWLIASMDSAFGTNYGLYQWPGVSTTQYYASYVDGPTG
SFNYSDSGSSHMDGSSSFWFANKNGDPDLAGLRYNNLIENGGGATPKDVLWYNPDNISAK
VDLPNDRLFKGIDTAFFRTNWTDSSMVFAGFHGGKNNSNHGNLDVGTFVLDAEGERWFID
LGGDNYSLPNYFGMEGRSTYYRGRAEGQNTVCVNPDKKADQVYTARGRITDYVSKPKGAY
AIMDMKSALGVLKVSQAQRGMLFTNNRRAVVLQDEMTLLEPGEVWWFAHTQADIEVAPDG
KSAILTQNGKRMSAVITSDNDAKFTVMDAVKLPTSPETHELETANTGIRKLAIHLTNVKD
VNLAVTFRMLEDGETEPSYKYTYTKMADWEIPDGTLEVPTATDVRVNGQTVENYNPYATD
YTVILPYGTTEVPTVEATAADGYEYTITMPESLPGTASIKVFDPNDRSISQTYSVFIRAE
KGVEIVASHNQEGNTPENSMDGDYVSRWAAEGSAWIKYTFIEPREISSVWIAYYSASETR
KAKLEIQVSEDGENFVSVFKGMSTASEVELEEFKLPQPMTVKAVKVLGEGNTVNNWNVIA
EIDFR

Enzyme Prediction     

No EC number prediction in MGYG000004085_01494.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	927	1100	1.5e-47	0.9720670391061452
CBM32	1267	1382	5.1e-16	0.9032258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	9.95e-31	432	515	1	84	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam00754	F5_F8_type_C	2.01e-09	1264	1382	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07833	Cu_amine_oxidN1	6.05e-09	395	462	31	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam16332	DUF4962	4.94e-06	548	709	121	290	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS27107.1	4.14e-160	547	1381	677	1507
QUH30172.1	8.16e-151	528	1377	31	885
QNK58643.1	2.10e-150	547	1383	772	1607
AZS17848.1	4.42e-150	428	1382	306	1274
QNK56587.1	2.74e-144	569	1382	221	1023

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JD9_A	1.06e-14	1270	1382	20	131	Structureof a pectin binding carbohydrate binding module determined in an orthorhombic crystal form. [Yersinia enterocolitica],2JDA_A Structure of a pectin binding carbohydrate binding module determined in an monoclinic crystal form. [Yersinia enterocolitica],2JDA_B Structure of a pectin binding carbohydrate binding module determined in an monoclinic crystal form. [Yersinia enterocolitica]
5ZU6_A	3.74e-12	1263	1379	35	151	ACBM32 derived from alginate lyase B (AlyB-OU02) [Vibrio]
7D29_A	1.05e-11	1257	1382	5	129	CBM32of AlyQ [Persicobacter sp. CCB-QB2],7D2A_A CBM32 of AlyQ in complex with 4,5-unsaturated mannuronic acid [Persicobacter sp. CCB-QB2]
5ZU5_A	9.75e-11	1263	1379	35	151	Crystalstructure of a full length alginate lyase with CBM domain [Vibrio splendidus]
5XNR_A	2.68e-10	1257	1382	5	129	TruncatedAlyQ with CBM32 and alginate lyase domains [Persicobacter sp. CCB-QB2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6XZB6	3.37e-08	536	840	7	300	Heparin and heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000738	0.788897	0.209554	0.000326	0.000252	0.000206

TMHMM  Annotations     

start	end
9	31