CAZyme Information: MGYG000004088_00765

Basic Information

• Species: Firm-11 sp900548145
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp900548145
• CAZyme ID: MGYG000004088_00765
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		36715.29	8.1467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004088	2947168	MAG	United Kingdom	Europe

• Gene Location: Start: 49174; End: 50151 Strand: -

Full Sequence      

MNKPMLSFVIPCYRSEHTIGAVVKELTDTLSTRPEYEYEIVLVNDGSPDNTAGALEALAR
QTPRVVFVDLSRNFGQHSALMAGFHQVKGDIVICLDDDGQTPACECFKLIDKVEEGYDIV
FAEYPERRQNWFRNLGSRFNAACNHFFFGQPRELKANSYYACRRFVVDAALQYPNPFPYV
TGLLFQSVSRYCNVPVNHRARMEGRSGYSLKKLVGLWFNGVTSFSIKPLRFATYFGFFVA
AFGFVFALVTIIRKLMNPAMQAGWASTISLILFMGGVIVLLIGLVGEYIGRIYLSINRYP
QFVVRRVMHGGEEEKHEDDARSLGA

Enzyme Prediction     

No EC number prediction in MGYG000004088_00765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	163	4.8e-31	0.9117647058823529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04187	DPM1_like_bac	1.65e-59	8	186	1	178	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.
PRK10714	PRK10714	5.36e-49	6	319	8	323	undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional
cd04179	DPM_DPG-synthase_like	4.78e-47	9	183	2	179	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04188	DPG_synthase	2.68e-27	8	140	1	142	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
pfam00535	Glycos_transf_2	6.06e-26	7	162	1	153	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI96750.1	4.42e-121	6	305	3	302
ARD65995.1	3.15e-112	6	309	7	310
ADO36390.1	7.28e-111	6	321	7	321
ALU15315.1	1.19e-109	6	321	7	321
QCT69832.1	1.19e-109	6	321	7	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EKP_A	4.08e-40	6	304	28	326	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKE_A	5.71e-40	6	304	28	326	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]
5MLZ_A	1.96e-12	6	206	25	229	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]
6P61_A	8.71e-07	2	98	11	102	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ5	2.74e-50	6	318	10	324	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnC PE=3 SV=1
A8GDR6	2.18e-49	6	316	10	320	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnC PE=3 SV=1
B4ETL6	1.68e-48	1	319	7	325	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnC PE=3 SV=1
B5XTK8	3.41e-48	6	319	10	325	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=arnC PE=3 SV=1
Q1C741	9.47e-48	1	318	3	324	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=arnC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
231	253
268	290