CAZyme Information: MGYG000004088_02244

Basic Information

• Species: Firm-11 sp900548145
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp900548145
• CAZyme ID: MGYG000004088_02244
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
879	MGYG000004088_68|CGC1	97324.34	5.0157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004088	2947168	MAG	United Kingdom	Europe

• Gene Location: Start: 6279; End: 8918 Strand: -

Full Sequence      

MSTVTLRENELQLNGKATTLLCASLFYFRIPRENWEERMDQLRMAGYNCIDVYIPWNFHE
LRPGEWHFEDEHDVSAFLALAARHGLYVIARPGPYICSEWDGGALPSWLYQPGAVLRQND
ETYLKALSGWLEKVLPIVAERQFTHGGSVVAVQLENELDFYGCTDPAGYMTRLHEIARGS
GIDVPLIACAGECDVQGCSGYVEDIYPAFNAYSDDYFAHLETQLHHMRELAAQRGGPLMI
TETNRVHAFLKRELLCGARLISPYNQVGGTDFDMTNGISNWASDIAKPLALMASDYDFVS
MITVDGRLREEAAEARLMASMMNALGEKLSASKPCVAPTALRCDFPCAQLLGEDGRDADL
FPSVELVCGWLMGASNLGEKDGILRFDTEDGEASLTVHGHKTVILPWKLDLSGYGCKGAS
ILWAEAEILSFRQTESGLEVSFVGDENARAMLSVGGEKHVVTGKVWTELNGLRVRILPRS
EAVFECPSLPPLTEAIPSVVSARETDHFRAQDVSVKELSHPLADRLCSMENAGQYRGDVF
YRFSVKGNDPVMLLSPADFLWISNGNGTKALYCDGSDLLLPAAEGEWQVRAQSWGHANFD
DVRQPSLHMGSGKGIEGAACIVEQQEITDLWYIFPYPKYRRQNRPDLRETDRILATTLNS
WSYPSAPMDADFERKVYFRPDCDCFWLQLEYPDSQVTVFVNDQPVGVLQPGVSLLRLNLP
EGLRGGATLRLHTVRRFSHTTLGRAHLLSGRRIAEGSMSGADVNVWRNIRPAEGGKAVRL
PVSLSPGQEVLLSGILPEGENRARTLVLEGSGIEATLVAHGHVCGRVELKTEGYPEVRGG
SSRRVYLPKGWSDDSVCLHLCGIGEGGALTAVRWEEIQR

Enzyme Prediction     

No EC number prediction in MGYG000004088_02244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	12	318	1.6e-75	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	3.31e-67	13	320	4	316	Glycosyl hydrolases family 35.
PLN03059	PLN03059	9.82e-30	1	297	27	318	beta-galactosidase; Provisional
COG1874	GanA	1.38e-21	13	165	10	165	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	6.37e-10	31	169	8	146	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18225.1	2.54e-149	1	875	1	865
QZD56038.1	2.88e-135	2	862	7	842
ALS29487.1	1.78e-133	4	877	11	931
VEH36899.1	1.98e-133	6	860	10	860
AEE47735.1	1.98e-133	6	860	10	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KDV_A	1.99e-42	14	362	28	387	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	2.12e-40	14	311	21	323	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	2.65e-40	14	311	45	347	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	6.34e-40	14	311	45	347	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
4E8C_A	1.28e-37	8	367	7	355	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23780	1.32e-41	14	362	45	404	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q58D55	1.10e-40	7	311	36	345	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
O19015	4.16e-40	8	311	39	347	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1
Q5R7P4	1.07e-39	14	311	44	346	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
P16278	1.44e-39	14	311	44	346	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004088_02244.