CAZyme Information: MGYG000004089_00833

Basic Information

• Species: UMGS1783 sp900555065
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; UMGS1783; UMGS1783; UMGS1783 sp900555065
• CAZyme ID: MGYG000004089_00833
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MGYG000004089_9|CGC1	64067.93	6.3512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004089	1656600	MAG	United Kingdom	Europe

• Gene Location: Start: 24608; End: 26368 Strand: +

Full Sequence      

MRERLKRAAAFLLCAVILSGALPLSDALSLSGAVEAADNRVGIVRGDALRVRSAPDTSDS
SNIVGYLNTGDTVTILDETTVSGSLWYKVNCKVESGATVTGYVHSDYINVVTESDDFEQY
LTDQRFPESYKNYLRALHAKYPNWVFEAVHTGLDWNTAVDEESVIPKSLVPRDSNSAYIN
LSDVDSNGNQIGRDGYSWVAASRAAVAYYMDPRNFLTESYIFQFESLAYSKNSHTEAGVE
SILKGTFMDKSHPFSVGGTSYTYAQAFMAAAKELGVSPYHLASRVRQEQGTTGTRLSGGT
VPGYAGYYNHFNIGAYTANGNSAETNGAIYAKNVSSSYYGPWTDPIRSIKGGAKILTSGY
VSCGQDTLYFQKFNVVTAPFYSHQYMTNIMAPSSESLSMKKAYSDNLNIALVFRIPVYKN
MPESAVPKPENQQPEQPVDPPGDTTPVLSSTTYTIGSGTITKIAEKTTASALLKGLTVKD
GYLRVVDRSGVEKSSKNVATGDVLQVLYKETRQVYKNYNIIIYGDVSGDGVCDILDLLRV
QKHLLKVQVQSGAYYTACDVSRDGTVNILDLLRVQKHLLGIMEIVQ

Enzyme Prediction     

No EC number prediction in MGYG000004089_00833.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	1.05e-23	188	419	38	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
cd14256	Dockerin_I	1.42e-14	523	579	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	2.21e-13	524	579	1	56	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
pfam08239	SH3_3	4.34e-10	47	108	1	53	Bacterial SH3 domain.
cd14254	Dockerin_II	6.45e-08	524	579	1	54	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT55084.1	2.62e-116	7	557	12	576
CCO04280.1	8.62e-107	17	551	9	552
QWT53775.1	2.54e-93	66	542	63	563
ADU22837.1	4.06e-93	5	429	3	431
ACR71571.1	3.03e-91	49	559	53	664

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.998704	0.000416	0.000202	0.000178	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004089_00833.