CAZyme Information: MGYG000004094_00107

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000004094_00107
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575		65392.04	6.297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004094	3605841	MAG	United Kingdom	Europe

• Gene Location: Start: 121058; End: 122785 Strand: +

Full Sequence      

MKNTNLFLTLLVACFFCVTTHAQEKVIVAYVTSWSEIMPDPAYMTHINYAFGHVNESFNG
VKIDNEERLKQIVALKSQAPQLKVLLSIGGWESGRFSEMAANDDFRRSFAKDCRRVVDKY
NLDGIDIDWEYPTSSVAGISSSPDDTQNFTLLMKDIRTAIGTDKQLTLATAANGEYINFR
AILPYIDFVNIMAYDMANAPQHHSALFRSVNAGKLTGDEAVNAHLKAGVPRKKLVMGMPF
YGRGGKEFANFMDYKKVDSSIKYTENWDDIAKVPYLTNENGVLVFGYETPRSLTIKCQYI
LNKGLLGGMYWDYDGDNEKGELRKAVYETLTGYTANYANKKRFKALVYYTTNAEEAHVTF
AKQGVEFFKKLNYGDGFDLQITTDLKGYTYNKLKEYDVVVMLNGYPMEKAERKAFQQYME
NGGGWMGFHAAAYNDKNTNWPWYVNFLGGGVFYCNNWPPQPVKVDIDNPHHDVTKNLPSS
FTAPESEWYQWSPSPRFNDDVEVLVTLSPDNYPLGIKDVVTAGDFPIVWTNTKYRMIYLN
MGHGDDEFTDATQKLLFINAFRWIVSKSPKGNPFQ

Enzyme Prediction     

No EC number prediction in MGYG000004094_00107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	24	325	9e-75	0.9695945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	2.39e-101	27	316	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	1.73e-83	26	316	1	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.28e-78	26	316	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	6.73e-69	27	316	1	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	6.75e-58	23	332	36	438	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH57945.1	2.55e-198	18	567	28	574
QUT62465.1	2.30e-197	18	567	21	567
QQA31016.1	2.92e-197	18	567	28	574
QUU00240.1	4.14e-197	18	567	28	574
QBJ17604.1	4.14e-197	18	567	28	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JQS_A	1.08e-135	332	574	6	248	Crystalstructure of a Putative thua-like protein (BACUNI_01602) from Bacteroides uniformis ATCC 8492 at 2.30 A resolution [Bacteroides uniformis ATCC 8492],4JQS_B Crystal structure of a Putative thua-like protein (BACUNI_01602) from Bacteroides uniformis ATCC 8492 at 2.30 A resolution [Bacteroides uniformis ATCC 8492],4JQS_C Crystal structure of a Putative thua-like protein (BACUNI_01602) from Bacteroides uniformis ATCC 8492 at 2.30 A resolution [Bacteroides uniformis ATCC 8492],4PXY_A Crystal structure of a Putative thua-like protein (BACUNI_01602) from Bacteroides uniformis ATCC 8492 at 1.50 A resolution [Bacteroides uniformis ATCC 8492],4PXY_B Crystal structure of a Putative thua-like protein (BACUNI_01602) from Bacteroides uniformis ATCC 8492 at 1.50 A resolution [Bacteroides uniformis ATCC 8492]
6INX_A	1.58e-53	44	330	27	342	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
3QOK_A	5.16e-50	40	330	50	416	ChainA, Putative chitinase II [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
6TSB_AAA	1.48e-49	40	317	50	340	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	2.34e-49	40	317	69	359	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	2.16e-41	22	334	41	456	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9W092	4.20e-36	19	335	35	410	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
Q13231	4.68e-34	27	320	24	367	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
P36362	1.26e-31	45	334	53	399	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
P48827	2.23e-31	45	318	85	385	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000199	0.999212	0.000191	0.000141	0.000127	0.000122

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004094_00107.