CAZyme Information: MGYG000004094_00402

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000004094_00402
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678	MGYG000004094_1|CGC4	76149.53	6.2645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004094	3605841	MAG	United Kingdom	Europe

• Gene Location: Start: 474082; End: 476118 Strand: +

Full Sequence      

MKRLSLVIISVILCFPLVRAQDSWVLKADNIDKDNYYGVSVGNGMLGLVSSAEPLKLKEV
VLAGLYDCYGNGRVASTVSTFNLLDMRLAIGWQDVTPSNVSNFTQQLDMRNGAFTGSFDF
KDIASVRYTYYALRQLPHTVMLDVTVKAHKKTAVLAENIMQTPAAFRDNRNYYNEVNPAH
AYIPLLTTVAQTPSGNATVVASNTFIFPEKHGEEPKVLHEMRHTNSHLMQFTRNLEEGEE
YTFSLIGNLLSSEHVADPYNQAERLAIYANLQGHDALLAAHNRAWEELWKSDIIIEGDKQ
AQQDIHSMMYHLYSFVREGTNNSLSPMGLSGLGYMGHVFWDTEIWMYPPLLLLHPEIAKG
LMEYRYRRLEAAKQNAFLHGYEGAMYPWESAASGEEETPVWALSGPYEHHITADIAIAAW
NYYLVTGDKDWLKEKGLPILQNTAAFWESRVTPNNGKYEIKNVVCADEWAENVDNNAYTN
ATAKLNLEYANEAARILGLPVNRKWKEIADNLVFAKMENGVTREHDTYTGQPIKQADVNL
LAYPLKVITDQAQISKDLKYYQEKVPYANTPAMTQAVFSLLHSRLGDGAEAYKWFKDAYE
LNLLPPFRVIAETKGGTNPYFITGAGGVLQTVMMGFAGLDISTEGGIRQIKSVMPSHWKK
LTITGIGSDKKTFTVTNK

Enzyme Prediction     

No EC number prediction in MGYG000004094_00402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	308	642	1.3e-107	0.9865591397849462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	3.88e-108	22	661	9	718	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	2.00e-74	309	639	4	380	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	1.07e-48	100	528	106	556	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	5.25e-05	40	243	18	231	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU92939.1	0.0	13	678	11	674
ASF42481.1	0.0	8	678	7	674
ATA70256.1	0.0	13	678	11	674
ATA79183.1	0.0	13	678	11	674
VEI53566.1	0.0	13	678	11	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	1.97e-315	21	677	21	678	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	5.83e-59	20	661	4	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	4.38e-40	231	678	225	734	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	5.88e-40	231	678	225	734	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
1H54_A	3.55e-36	40	670	30	718	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	2.94e-76	19	641	18	627	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q8L163	6.64e-66	272	662	291	733	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
Q8RBL8	9.19e-62	272	662	288	730	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1
F1NZI4	1.20e-61	236	678	201	651	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q32M88	1.77e-59	271	645	221	608	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000400	0.998719	0.000358	0.000176	0.000151	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004094_00402.