CAZyme Information: MGYG000004094_01041

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000004094_01041
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000004094_5|CGC2	42523.51	7.79

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004094	3605841	MAG	United Kingdom	Europe

• Gene Location: Start: 27216; End: 28352 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASNLMAALKKEDSEAEFRFFGGDLMAAQGGTRVKHYKELAYMGFI
PVLLHLRTIFANMKHCKEDIVAYAPDVVILVDYPGFNLSIAKFVKEKTSIPVYYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEVDFFHKHDYPIHYVGNPCVDAVAVFRDNGKETFQE
FVSSNCLPDKPIIALLAGSRKQEIKDNLPDMIRAASAYPEYQLVLAGAPGIEPDYYRKYI
GSANVSILFGKTYSLLEQAEAALVTSGTATLETALFRVPQVVCYHTPIGKVISFLRKKIL
KVKFISLVNLVADKEVVKELVADTMTVENIRVELGKILNDKEYRGQMLDSYDRIIDILGP
AGASQHAATRMIGLLKAL

Enzyme Prediction     

No EC number prediction in MGYG000004094_01041.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	1e-113	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.47e-101	1	376	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.06e-91	1	377	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.58e-72	4	372	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.78e-61	5	371	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.67e-48	1	330	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM56429.1	1.50e-212	1	376	1	377
QCQ44785.1	2.51e-212	1	376	1	376
QRM69747.1	2.51e-212	1	376	1	376
QLK82175.1	2.51e-212	1	376	1	376
AUI45272.1	2.51e-212	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.89e-38	5	376	11	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.32e-37	5	376	11	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.41e-63	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	7.28e-63	5	375	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B3E4H8	1.13e-60	2	376	8	381	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	1.63e-60	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	2.23e-60	5	376	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004094_01041.