CAZyme Information: MGYG000004094_01087

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000004094_01087
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000004094_5|CGC3	55547.41	7.0268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004094	3605841	MAG	United Kingdom	Europe

• Gene Location: Start: 90315; End: 91772 Strand: +

Full Sequence      

MKKNLLALFAALFMSVSIAYADAPKTYLPWSNGKLVVSEEGRYLKHENGAPFFWLGDTGW
LLPQRLNRDEAEFYLEQCKRRGYNVVQIQTVNGVPNMNFYGQSSMPDGFNFKDINKKGVY
GYWDNMDNIIKTAERKGIYIGMVCIWGSPVARGDMNVEQAKAYGKFLAERYKDSPNIIWF
IGGDIRGDVKTEVWEALAHSIKAIDKNHVMTFHPRGRTTSAAWFNGADWLDFNMFQSGHR
RYGQRNGDGDYPIEENTEEDNWRFVEASQSKTPLKPVIDGEPIYEDIPQGLHDPNETRWN
ANDVRRYAYWSVFAGSFGHTYGHNSIMQFTHPGVGSAYGAKKPWWDALEDPGFNQMKYVK
NLMLTFPYFERIPDQSIIVGQNGERYDRAIATRGNDYMLVYNYSGRPMQIDLGKISGAKK
NAWWYSAKDGKLEYIGEFGNGTQAFQHDSGYMSGNDQVLIVVDAAKNYVGKDWKELPDAQ
QKWNK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	33	459	5.4e-171	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	4.69e-154	41	366	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	4.12e-41	372	461	1	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ45266.1	1.42e-310	19	485	22	488
QGT69955.1	1.42e-310	3	485	5	488
SCV09603.1	1.42e-310	19	485	22	488
QRQ56895.1	1.42e-310	19	485	22	488
QDH55646.1	1.59e-307	3	485	5	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	3.79e-301	19	476	2	459	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	5.12e-295	20	485	16	484	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
3KZS_A	4.98e-290	19	476	2	459	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000294	0.998953	0.000194	0.000185	0.000180	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004094_01087.