CAZyme Information: MGYG000004094_01145

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000004094_01145
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000004094_6|CGC2	36476.55	8.5351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004094	3605841	MAG	United Kingdom	Europe

• Gene Location: Start: 47944; End: 48912 Strand: -

Full Sequence      

MLMDRFWKIFFLLIVVRTSLLAANYPLAGDTVVVSRDGTGNFRTVQEAVESIRAFMDYTV
VIYIKSGTYKEKVVVPSWIKNVEIVGENAKTTIITYDDHANINKMGTFRTYTVKVEGSNI
TFKDLTVENNAPQLGQAVALHTVGDRLMFVNCRFLGNQDTIFTGAERTHLLFTNCYIEGT
TDFIFGPSTALFENCIIHSKRDSYITAASTSQESEFGYVFRNCKLTAAAGVTKVYLGRPW
RPYAATVFMNCEMGKHIVPSGWHNWKNPENEKTARYAEYKSTGEGASLKERVKWSKQLTD
AEARKYSVENMFSGTADWYPYK

Enzyme Prediction     

No EC number prediction in MGYG000004094_01145.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	32	313	5.5e-106	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.93e-88	34	318	9	302	pectinesterase
pfam01095	Pectinesterase	3.06e-83	32	314	2	297	Pectinesterase.
PLN02682	PLN02682	2.01e-75	31	306	70	355	pectinesterase family protein
PLN02432	PLN02432	3.49e-75	32	318	13	291	putative pectinesterase
PLN02665	PLN02665	9.45e-69	31	306	69	348	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY38333.1	4.05e-161	30	320	24	314
ALK82867.1	4.05e-161	30	320	24	314
QEW38158.1	4.05e-161	30	320	24	314
ABR39474.1	4.05e-161	30	320	24	314
QQY41711.1	5.75e-161	30	320	24	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	3.49e-44	29	314	6	304	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	9.83e-43	33	314	6	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	2.75e-34	34	291	13	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.46e-33	34	291	13	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	2.58e-30	35	320	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	7.58e-61	34	303	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O49298	7.16e-52	19	314	238	539	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q9FM79	8.39e-52	32	306	82	366	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8VYZ3	1.27e-51	36	318	90	380	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9SIJ9	9.05e-51	34	318	53	331	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001948	0.996932	0.000419	0.000209	0.000212	0.000237

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004094_01145.