CAZyme Information: MGYG000004094_01570

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000004094_01570
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648	MGYG000004094_10|CGC2	73454.12	4.9499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004094	3605841	MAG	United Kingdom	Europe

• Gene Location: Start: 49009; End: 50955 Strand: +

Full Sequence      

MKNSLKSILFAFTTLAMVQCAPPVHKVAFDSTKELSGQKFALKDINPELPADWDDYNYVV
LEYKISTPQRFQLGFTTDNGYNELRIMSYVPNAWNKLAIPLKYFTELPDAAVDLAATFNH
ARYMGWVNLGGKRGPLHGVDSVGVRMRKPIGAPTIEIRNITLAVDDPGDVYMGEQPAIDE
FGQSTLVDYPEKAASLEELEAEWRAEENEVVSTEAYNYSKFGGYKQQQVKGTGFFRTEKI
GDRWWFVDPEGYLFLSVGIDCVGVGGGGNIRDVEHRAGMYKELPPADLMERFGKQGRRRA
NNGSFGLWNQVRRFGDDFPTKSKELVIKRMDKWGLNTIANWSDNEIMAMNRKAFLLPLHG
LGLAPDLMGLCDIYDSEFQAMIDKNLSETTKDLKDNPWLVGYFIGNEPAWLNEEVRLCDL
ILTGKERPIKGALQQYLAKNGDNEQNRKDFVHETFRSFLIDVNKTLKKHDPNHLNLGIRF
GDPDKLQPEILKICSETFDVFSFNCYQLVPDEAMLSRALEITGLPMIIGEYHFGTVDRGL
AQSLWQVNSEAQRGVAYRYYTENAYAHPGLIGTGYFQWCDQDITGRFDGENYNCGLIDVT
DRPYKEQVEAMMETAKVLYNVHSGNQAPFDQAPVDARGHEAIPDLWNK

Enzyme Prediction     

No EC number prediction in MGYG000004094_01570.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	139	620	1.3e-90	0.8315467075038285

CDD Domains     

MGYG000004094_01570 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP07832.1	0.0	15	648	16	645
BBE17136.1	3.40e-309	12	648	40	667
SCM56829.1	2.74e-305	11	646	10	644
AHF13634.1	3.57e-277	29	647	30	646
ASB49335.1	1.85e-267	5	648	3	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	5.65e-56	45	626	56	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.45e-55	45	626	56	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	5.40e-54	16	619	50	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	2.37e-50	178	619	223	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	9.50e-46	125	619	383	949	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	5.67e-32	179	635	400	956	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000714	0.223195	0.775659	0.000134	0.000152	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004094_01570.