CAZyme Information: MGYG000004095_01201

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822
• CAZyme ID: MGYG000004095_01201
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		55103.01	8.1908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004095	1534718	MAG	United Kingdom	Europe

• Gene Location: Start: 352; End: 1800 Strand: -

Full Sequence      

MIQTIRRHPYAFLLLFSAYLYLIGNPLLSVTDTAEANYALTAKEMVLSGDWMSPQIYGRY
WYDKPIFYYWELAASFAVFGFNEWAARLPSAVLGCGNVLFTFWFARRVYGERTAWGAAVI
LGTALEFWLLSKAVITDASLFFFMSASVAFFYLGYTEDRQYYWLCWLAAALAVLTKGPIG
VLLPGFSCLLFLLWKRDLGEMRHVHFFSGLLLFLLIGGSWYYGMYRLHGSDFLVNFFGVH
NFLRATVPEHERQNVWYFYLMMFFAGFAPWSFAFPVSLYRRWKRRHALPPPADADRFFLV
WAFSVLLIFQIIATKYTTYTFPSLFAFALLAARLWRGRLTAVLRAGAAMTAVYTALALVA
APLATLHFSGASVGTDLAQMDTGGAPVLFYDGYRTSAVFYSGLPIYRLTTEKEKEALQPD
GISWNAKNVMPFFTEEELRAEPGPYLIVLEEKAKDRFLHTHEGTARRIIDAGDYLIIDWE
QA

Enzyme Prediction     

No EC number prediction in MGYG000004095_01201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	378	4.8e-99	0.6703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.74e-51	1	335	1	336	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
237330	PRK13279	2.02e-22	6	333	4	331	arnT lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	5.86e-16	63	194	1	131	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	8.70e-13	12	196	4	203	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25530.1	6.06e-185	1	476	1	478
AXB81444.1	2.16e-171	3	451	2	450
QNH54574.1	1.59e-120	20	457	17	453
AEB99017.1	4.09e-120	7	473	6	482
ANR69759.1	2.87e-118	20	457	17	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.43e-31	35	331	59	360	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	4.65e-30	35	332	30	318	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	2.79e-29	21	259	16	241	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A6V1N8	1.49e-25	6	330	3	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
Q4K884	1.38e-24	3	367	33	396	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q02R27	5.21e-24	6	330	3	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.900535	0.098532	0.000355	0.000161	0.000149	0.000275

TMHMM  Annotations     

start	end
12	31
66	81
88	110
114	131
138	156
171	193
206	225
255	277
297	314
318	335
342	364