CAZyme Information: MGYG000004099_00990

Basic Information

• Species: Eubacterium_R sp000433975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp000433975
• CAZyme ID: MGYG000004099_00990
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000004099_3|CGC1	93060.45	7.6154

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004099	1856381	MAG	United Kingdom	Europe

• Gene Location: Start: 11910; End: 14363 Strand: +

Full Sequence      

MERMSLAGKWILHMDKQDRDYEADVPCSDYGTLLKNGAIDDPFYKTNEHKCLFIAETGKS
FKRSFKISQEQLEYRKALLRCQMLDTLAQIYINGQMADISSNAYVCSETNITDYLHEGEN
TIEIHFLSPIEYVKSKQSEAPLPPNANGIDGVPYIRKPACHFGWDWGINMPVSGIFGNIE
ILFYNNEIRDFWVRQEHSENGEVKLYIKANKALDSSGQIITPSGESIAFGIEKGNACVTI
KNPELWQTRELSGKEKQPLYTVCVAGIKKRIGLRTIVLDRSEDEYGSNFRFILNGVPIFA
KGANVIPPDAMADRIGKKTAEKIVSDAVHANFNMLRIWGGGYYGSDELYDLCDEYGILVW
QDFMFACLMYPFYDEVFLKNVLDEVKYNVRRISSHPSLALWCGNNEIEFMFQHLPSTLKI
VKWYKEFFYEILPGELRRYDKDTPYIETSPIGSGFRKDITADKCGDTHMWHVWHGSKDLS
YYGKRYTRFCSEYGMESFPSEDCILQFATQKDMQLKSDVMQSHQKCASGNDKMLFYLYEK
FNKPAKFADLIYLTGLTQAECVANGAEHWRRNKGRCNGALWWQMNDCWGAPSWSSVDYFG
KWKPLMYAGKRIFAPITISLRQADGGIELYVLNGTQKNEEYTAVITFKDFTGKELRSKSL
LIKSHAGESQKAFYISAGGLKKASCFAQAELLKGGKTVLSRTAVLLPERKLKLQHAKITL
YLSGNEMTLESNTFARSVFVDIKGESAPLSDNCFDLVPGEKKTIRLEKDCKIDPKSISVK
CVNNITYAGGDAERIRFRMAFSAQPMNIANKIYYSIS

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	668	1.4e-86	0.6821808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.77e-81	1	768	10	786	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	4.40e-14	715	784	5	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	2.65e-10	30	409	90	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	9.90e-08	625	712	1	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam02836	Glyco_hydro_2_C	1.13e-05	291	404	8	134	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUG59052.1	3.27e-184	4	777	3	802
BCJ98156.1	2.50e-177	1	756	1	791
QUO31658.1	8.07e-167	1	768	1	797
ADZ84812.1	8.77e-165	1	768	1	797
QLG40119.1	1.69e-164	4	769	4	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	3.00e-130	2	764	7	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.15e-130	2	764	9	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.23e-130	2	764	9	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	8.48e-130	2	764	7	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	3.41e-128	2	764	7	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q29444	3.14e-93	4	694	23	760	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q95327	1.62e-92	4	754	23	844	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q0CCA0	4.13e-90	3	658	6	710	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4FZV0	4.31e-89	5	648	24	721	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q5B7W2	2.10e-88	25	660	32	703	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004099_00990.