CAZyme Information: MGYG000004104_00461

Basic Information

• Species: HGM13233 sp900762805
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; HGM13233; HGM13233 sp900762805
• CAZyme ID: MGYG000004104_00461
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	MGYG000004104_3|CGC1	71141.09	6.3397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004104	1771990	MAG	United Kingdom	Europe

• Gene Location: Start: 83069; End: 84931 Strand: +

Full Sequence      

MDNQAIYYFHQGTNYCAYEYLGAHRTPAGDVVFRVWAPHAAAVSVVGDFNGWNQTAAPMQ
RVSSAVFEAVLPGVKQYDSYKYCIRTADGRTLFKSDPYAFHTQTRPENASKFYDISGYVW
QDGDYMAARRPQYDRPVNIYELHIGSWRTHEDSSPLSYLELAEQLPAYLKEMGYTHVEFL
PVSEHPFDGSWGYQVTGYFAPTSRFGTPHDFMALVDALHIAGISVLLDWVPAHFPKDDFG
LYEFDGGCCYESEDPLLREHREWGTRQFDYGRNEVQSFLVSNAIFWLGQYHIDGLRVDAV
ASMLYLDYGRKNGEWRPNSHGGKENEAAVAFFRKLNAAVFARFPDAMMIAEESTAWPLVT
APASAGGLGFNFKWNMGWMNDTLRYISTDPLWRSQLHNNLTFSMSYAFSENFVLPLSHDE
VVHGKCSLINKMPGDYEQKFAGLAAYLAYMMAHPGKKLFFMGTELAQFIEWDEKKQLDWL
LLEYPAHAAFHRFVRLLNCFYREHPAFYEIENDWSGFRWISVDDRDSNVIAFMRTDRAGQ
QVIVACNFSGVDHAGYRLGVPQAGSYRVVFDSKALDHAQDKLHASVRSRKQPMRDFEHSI
EVDMKSLSTVYIIQQKRKKS

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	168	467	3e-155	0.9933554817275747
CBM48	21	102	5.9e-19	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14706	PRK14706	0.0	21	572	27	578	glycogen branching enzyme; Provisional
PRK12568	PRK12568	0.0	1	616	107	730	glycogen branching enzyme; Provisional
PRK12313	PRK12313	0.0	3	620	9	633	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	18	577	620	1180	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	6	611	105	720	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATL90043.1	4.35e-285	6	611	17	630
CBL01646.1	3.46e-284	6	611	17	630
QIA41789.1	3.54e-284	6	611	17	630
ATO99826.1	3.54e-284	6	611	17	630
AXB29737.1	7.64e-283	6	611	17	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	6.64e-202	11	615	4	615	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
3K1D_A	1.89e-201	6	574	106	679	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
4LPC_A	9.08e-201	18	615	6	610	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GR1_A	9.12e-201	1	574	129	731	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR0_A	2.58e-200	1	574	129	731	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	2.81e-224	7	611	12	624	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
O66936	2.12e-221	6	612	12	626	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q8DLB8	1.39e-214	6	577	111	711	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q1AZ86	1.72e-212	1	612	99	717	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q3SH78	8.84e-212	6	612	121	736	1,4-alpha-glucan branching enzyme GlgB OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004104_00461.