CAZyme Information: MGYG000004105_00445

Basic Information

• Species: Alistipes_A sp900546005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900546005
• CAZyme ID: MGYG000004105_00445
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860	MGYG000004105_2|CGC3	95302.56	4.7006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004105	2464466	MAG	United Kingdom	Europe

• Gene Location: Start: 125973; End: 128555 Strand: -

Full Sequence      

MKLRLSKRVVPNLMAAGMTLLALSGCTKQEGKGIYRTEALDNQAWESSTWISVVNAPVVT
GIVVDGTRAADGANWFVSTIKNPQKVTSARWMTSALGVYDIYVNGQLIGNEILKPGFTHH
DKTKLSFTYDITDAFNTGADAENVLSAQVTPGWWADKIVTPAGHDGMIGKKCAFRGVLEL
TYADGSKQIFGTDTTNWKAGIAGPVTHAAIFDGEEYDARIQPGYETPDKMSTPEVNTEFN
GELVPSKGAEVYFRHDLALAPVKAYTWEGVTGESDEEFGKIIVKQEYKAGEPMTIKPGEH
LVIDFGQNCAAVPSFVFNAAEGTVLECITSELLNDGNGAKSRGMDGPEGSVHRLNLRIPD
TGMKLKYTFANSTDDATYLPRATFFGYRFVSITASDEVTIKKIESIPVTSISKEMECGTI
TTGNDMVNKLISNTLWGQRSNYLSVPTDCPQRNERLGWTADTQVFTETGSFFANTASFFH
KWMRDMMDTQSETGGFPGVAPLSQYGNDMMRLGWADAGIIVPWTIWKQFGDTEIIDQCWE
SMDKFMNHINDTKYDHNTLINENLNYQWADWLSYEPLESCGGGAFGKDGPLPEAVDYWNY
LSASYWMIDAGMMRDMAAATGRDASRYEQMVADAKAYIKEKFFTPEGMFKTEILNTMQTP
ALFALKNGILDGKAKEDMIARLRQNFAEHDNCLQTGFLGTSILMPTLTENGMSDIAWELL
LQRKNPSWLYSIDNGATTIWERWNSYMIESGMGPRGMNSFNHYAYGVVCEWIWESVAGIA
SDPANPGFKHIIMKPVPDKRLGSVDAVYNSAAGCIKSSWKYEGDKWIWNFTIPEGCTASV
TLPGETEAKEYTAGEYSVIK

Enzyme Prediction     

No EC number prediction in MGYG000004105_00445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	296	842	2.4e-141	0.9900793650793651
CBM67	65	227	1.2e-17	0.8181818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.37e-106	418	776	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.58e-34	85	228	2	141	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.75e-17	778	850	1	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	6.02e-09	294	406	2	99	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ47829.1	0.0	36	860	34	856
SCV07234.1	0.0	36	860	34	856
QRQ54718.1	0.0	36	860	34	856
QUT31728.1	0.0	36	860	34	856
QUR45392.1	0.0	13	860	11	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.26e-105	44	856	286	1009	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.31e-83	88	845	146	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	9.91e-65	73	843	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	3.88e-106	40	843	144	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	5.49e-105	44	856	286	1009	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	3.46e-96	78	859	165	885	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.38e-50	40	842	141	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004105_00445.