CAZyme Information: MGYG000004105_00771

Basic Information

• Species: Alistipes_A sp900546005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900546005
• CAZyme ID: MGYG000004105_00771
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000004105_3|CGC3	72540.67	5.4798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004105	2464466	MAG	United Kingdom	Europe

• Gene Location: Start: 216492; End: 218420 Strand: -

Full Sequence      

MKKLFALLLLSGIALHGQGQKRMPHYKLTPVPAANVTLTDSFWKPRIETAFHEGFDWVTL
HFDPNNGGYRTFRESQRRDTVKVEPVTTFESIKVLEAAGEYLKYNEDPDMEAYMDRCIDH
WVLSQDKSGYFTGICLGDQQVFGHVAKGRWNNLQYSHELYGVGHLLEAALSYAEATGKTK
ILEAALRATDQVFSIFGPDKRQDVPGHEEIERAFTRYYEATGDKRFLDLARFFIDERGDH
TTRDSYGEYAQDHLPFIEQRHVSGHGVRGAYLYIGATDVVGATGDEGYRTAIDSIWKDMT
ERHMYITGATGVIHAGNEGYGEPYNIAPEDCYGESCCAIANSVWAHRLNRLYADASYMDQ
FEKIVYNTFLSAMAFNGQGMFYCNHVNRTTPDQRSWAGCPCCPGNVLSHYARIPSYVYSI
SDEGIYLNLFVDSKAHIPFGKGVSVTQQTEYPWEGKIAVEINPEEEGTFGVFIRIPEWAE
SHAIRINGKSVEATIDRGYALLERTWESGDRIEIEFPMEARRAYMPEPFSGYDGLVALRR
GPIVYTFEGIDNFGTVCNLLLPVKAPLKSVKSDILGGIVQIEATGRVLDWDGRWINRKIT
AIPCGLYSNRGTSVHYVWIAEEPEQVKEPEYHMNTLLPPPGL

Enzyme Prediction     

No EC number prediction in MGYG000004105_00771.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	36	545	1.5e-144	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	1.14e-130	93	622	70	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	6.63e-129	35	545	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04791	LanC_SerThrkinase	2.68e-05	168	295	94	230	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNN24698.1	3.04e-131	1	627	1	653
QEC63214.1	3.42e-128	1	627	1	662
QOY86391.1	8.43e-128	26	619	26	652
AEV97381.1	2.01e-127	2	628	4	665
ASV74087.1	5.14e-127	27	621	34	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	3.27e-108	26	619	5	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	6.72e-103	33	622	13	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.22e-99	33	622	13	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.49e-75	39	619	47	694	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.15e-71	35	582	2	606	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.32e-71	35	582	2	606	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002132	0.904402	0.092645	0.000298	0.000256	0.000248

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004105_00771.