CAZyme Information: MGYG000004105_01285

Basic Information

• Species: Alistipes_A sp900546005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900546005
• CAZyme ID: MGYG000004105_01285
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		31701.45	5.6976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004105	2464466	MAG	United Kingdom	Europe

• Gene Location: Start: 115569; End: 116387 Strand: -

Full Sequence      

MSNCKILYVCQEITPYLAENDMSVLCRALSQGMQEKGNEIRTFMPRYGLINERRNQLHEV
IRLSGMNLIIDNNDHQLIIKVASIPAARVQIYFIDNEDYFHRKAIIRDENGKLFPDNDER
AIFFARGVLETVKKLRWTPDIVHCHGWMSSIVPVYLRNLFADDPIFKKIKIVMSLYDEAF
EGELDSNFKAKVQGEGVPKKYLAPLEHPTYENLMKFVSNYVDGVIYETPKPDPKLVECFE
EKNIASLAFQDKSNPEYLDRYLEFYNKILANE

Enzyme Prediction     

No EC number prediction in MGYG000004105_01285.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	224	2.6e-44	0.4427966101694915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	2.14e-57	6	215	1	204	Starch synthase catalytic domain.
PRK14098	PRK14098	1.04e-47	2	177	4	180	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	6.19e-37	5	224	1	212	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.23e-28	5	215	2	192	glycogen synthase GlgA.
COG0297	GlgA	1.77e-27	5	226	2	214	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23346.1	2.93e-172	1	272	1	272
AFL77981.1	6.67e-131	5	268	4	267
BBL11572.1	4.47e-129	5	268	4	267
BBL08780.1	4.47e-129	5	268	4	267
BBL00775.1	1.81e-128	5	268	4	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	1.48e-10	5	192	2	179	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNF_A	5.66e-07	5	209	23	231	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4S584	7.24e-43	2	220	4	221	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
A1BIY8	2.65e-42	3	197	5	200	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
Q3B6C3	3.69e-42	3	197	5	200	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B3EGV0	1.39e-41	3	197	5	200	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
B4SC83	2.73e-40	3	197	5	200	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004105_01285.