CAZyme Information: MGYG000004107_00647

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11
• CAZyme ID: MGYG000004107_00647
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506		55643.81	5.3264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004107	2102916	MAG	United Kingdom	Europe

• Gene Location: Start: 6309; End: 7829 Strand: -

Full Sequence      

MQSHQTAAQMVKEMTLQQKLGQMFVTGFPAESINDSFIQLVKEQKLGNVILFKANLTDYA
QTLQLSRDLHLLIRSQTGVPPFITIDEEGGVVSRLPEDMPKMPSAMALSSLKDPQKVYRA
ALRSGQLLRSLGINFNLAPVLDINSNPQNPVIGIRSYGQNPQDTWTYAAQALQGYLDAGV
MCSGKHFPGHGDTMADSHLELPSSGKTLDQLRQTEMFPFAQAVKAGLPGATIAHVVYSTL
DDVPATMSHKIVTGLLRQELGFQGLIISDCMEMNAISRTYGIEEGVIRAVQAGIELIFVS
HLHDKVRSSMEALAAAVEQGRVSMTAIDAAVERILTYKQQYAYEEPLDDQQPLSACRQAA
DELFRDVVQADRPFALGERPCFISPAQAQVSQVSNAEDSLCFAQEMQRRFGGRCVRLPLR
PGPEDLTQALAAADGATSIVMGTLNATVYTGQLDILLALEKLDLPMACVTFCNPFELDRL
KPDTCRVRAWEYSPRALERVMTFFAK

Enzyme Prediction     

No EC number prediction in MGYG000004107_00647.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	75	298	2.3e-54	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.68e-83	14	362	1	336	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.35e-82	15	336	1	315	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.80e-51	47	322	27	302	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.34e-14	8	338	39	353	beta-glucosidase BglX.
PLN03080	PLN03080	0.003	218	331	249	356	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV19927.1	1.36e-136	11	506	3	507
ADL06121.1	8.15e-133	13	504	11	512
QRV19764.1	3.26e-132	14	504	1	501
SET94154.1	4.57e-129	13	504	3	504
QUY18004.1	1.49e-125	16	497	6	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	8.47e-87	12	344	9	343	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	3.46e-66	16	498	9	507	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	1.93e-63	7	338	35	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.29e-63	7	338	9	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.12e-62	7	338	39	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.06e-62	7	338	35	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	3.89e-48	3	338	7	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q3SKU2	1.43e-40	46	311	28	297	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
Q5QUZ5	1.91e-38	39	299	19	276	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
Q2Y863	2.83e-37	46	299	28	282	Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004107_00647.