CAZyme Information: MGYG000004112_01184

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae
• CAZyme ID: MGYG000004112_01184
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		35387.31	4.249

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004112	1854194	MAG	United Kingdom	Europe

• Gene Location: Start: 115; End: 1080 Strand: +

Full Sequence      

MPHYDYTENLTTEKFIAVIGEQARAIAQESDLYASVMIAQAILESGSGQSELSKAPNNNL
FGIKGSWEDEKGQKHSVSFLTSEDNGSGALYQIVSDFRAYDTVADSLQDYADLLTKDMGA
FYQGAWKKNAKTYEEAAKYLQGRYATDTSYAAKICGLIETYHLDRFDEALAWTPVDEDVD
LTDLLAEATSHLGTAYVWGGASPLTGFDCSGLIQWSYKEALDIDLSRTTYTQCLEGQLVS
FDDLHPGDLLFFNNNGDVHHVALYLGDGFYIHAPQTGQPVQVTSMEEYAPSFAKRIVETR
PVEEPPVVSKVLSGLKSVLFG

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	20	163	7.5e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	4.94e-57	7	167	315	472	amidase domain-containing protein.
COG1705	FlgJ	2.72e-53	12	169	43	190	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	5.62e-46	11	167	149	303	1,4-beta-N-acetylmuramoylhydrolase.
COG0791	Spr	1.31e-32	182	300	76	197	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
pfam00877	NLPC_P60	1.40e-30	193	300	1	104	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAN76613.1	3.56e-93	6	303	388	786
BCA89113.1	2.29e-92	6	303	312	710
BCS56788.1	2.39e-92	6	303	314	712
ACV23790.1	2.75e-71	6	303	238	635
VEH03449.1	4.27e-71	6	303	261	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.71e-37	13	167	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	3.28e-35	4	168	52	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
6B8C_A	1.05e-25	184	298	31	144	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
7CFL_A	2.23e-17	184	302	17	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
6BIQ_A	3.88e-15	172	288	146	265	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G222	5.91e-34	4	168	312	473	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P39046	1.07e-29	10	167	60	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P37710	2.23e-29	14	167	182	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	4.92e-27	11	169	61	216	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	1.31e-26	11	169	61	216	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004112_01184.