CAZyme Information: MGYG000004114_01079

Basic Information

• Species: CAG-95 sp000438155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000438155
• CAZyme ID: MGYG000004114_01079
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000004114_9|CGC1	37523.27	4.6062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004114	2992180	MAG	United Kingdom	Europe

• Gene Location: Start: 79654; End: 80616 Strand: +

Full Sequence      

MRTIPCNPNAQPEVKEVLEYLSQIEGKGILTGQHTQTMEQPEIWRIEKLTGKLPAICGFE
LLSYSPNIRRETADEECLKEVDENTGTLEKAWEWAERGGLMTFTWHWFSPLGGNDKSFYA
EKTDYDAAKAVMEGTPEHEALCHDLDHMAGVLQPFCDRHIPILWRPFHESEGEWFWWGAK
GPEVAAELFRFMFRYYTQHHHLDNLIWVWNSPLPEGYVGDEYCDIISRDLYTEPHVHGAY
EEQYEELLKVTKQDKGAALGEIGILPDPETLMEKKIPWLWYMTWSFDFALNEKFNSDTAL
KKLYESSYAIDLEEYQRRRR

Enzyme Prediction     

No EC number prediction in MGYG000004114_01079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	7	314	2.5e-92	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.69e-52	7	314	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	2.12e-10	152	231	164	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK45707.1	1.33e-148	1	313	2	315
CQR54080.1	2.44e-147	1	317	5	322
QUL56288.1	1.63e-145	5	317	9	322
AIQ66101.1	6.83e-145	5	314	10	320
AIQ67637.1	7.64e-144	5	317	9	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	3.42e-65	7	316	147	448	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	3.59e-63	3	314	4	309	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6Q75_A	1.79e-43	5	316	23	328	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.14e-42	5	313	34	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.51e-42	6	284	46	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	8.66e-68	7	316	176	477	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A2R6F5	1.18e-53	9	312	32	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
Q5AWB7	5.52e-53	3	316	26	351	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55296	3.79e-44	7	314	159	459	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P49425	4.00e-44	5	314	139	456	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004114_01079.