CAZyme Information: MGYG000004114_01279

Basic Information

• Species: CAG-95 sp000438155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000438155
• CAZyme ID: MGYG000004114_01279
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000004114_12|CGC1	72670.61	5.1434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004114	2992180	MAG	United Kingdom	Europe

• Gene Location: Start: 62090; End: 64018 Strand: +

Full Sequence      

MGDLQLVKKFKVNDGFFGRYEKLVKDVVLPYQEKALNDQIEGADKSHCIENFRMAAEKLK
TGKCNGEFYGMVFQDSDVAKWLEGAAYSLAQYPDAELERRCDEIIDLIGEAQQEDGYLNT
YFTVKAPDKRWTNLQEAHELYCAGHMMEAAVAYAECTGKIKLLNIMCGMADHIYKHFIEE
GAEGYSGHPEVELALLRLYRCTKNEKYKELALHFINVRGVDSDYFRKEKERRKWTVWNAD
PEDKEYTQCGAPVREQTKATGHAVRAVYLYTGMADAAMETGDTALAEACKTLWNNITQCR
MYVTGGIGSAYEGEAFTRDYHLPNDTAYAETCAAIGLIFFANRMLYLERDRKYADAMERA
LYNCVLAGMQLDGTRFFYVNPLETLPGISGEAKTHRHALPVRPKWFACACCPPNVARTLS
SISEYAWHMTRDTLFSNLYIDGTLDLTENFGGKIILETAYPYDSVINYKFAPEKETMYVP
LAIRIPAWSENTKILLNGKPAEYGMKAGYAYISGEYGAEDIITVELDMEVKRVYTSTRVA
ANSGKAALQRGPLVYCAEGVDNDNDVLSLSLKKDGKITLGEYIPDKLCGIQELHAEGYRE
AVSDDLYSYDAPVTKECQITLVPYYTWANRGLNQMRVWIPIR

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	11	556	9.7e-208	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	1	639	3	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	9.81e-156	11	556	3	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04792	LanM-like	0.007	151	223	602	696	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ60849.1	0.0	6	640	4	636
QEH67728.1	0.0	6	640	4	636
ADZ82012.1	0.0	6	640	4	636
BCN30788.1	0.0	6	640	4	637
CBK96106.1	6.54e-236	13	641	14	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	5.50e-204	12	639	18	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.48e-195	12	639	18	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	2.10e-144	12	637	5	654	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	2.91e-144	12	637	5	654	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	8.19e-144	12	637	5	654	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.15e-143	12	637	5	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004114_01279.