CAZyme Information: MGYG000004114_01442

Basic Information

• Species: CAG-95 sp000438155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000438155
• CAZyme ID: MGYG000004114_01442
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	MGYG000004114_15|CGC1	95046.67	4.6159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004114	2992180	MAG	United Kingdom	Europe

• Gene Location: Start: 14929; End: 17406 Strand: -

Full Sequence      

MKTKLLNGTWNLKILGKDAGLTGEAGLPAEVPGSVYATLLTEGKIEDPYYRDNELKTLPI
MDNDFCYTTRFEVEPEWFSMDGLFLRFDGIDTLADIYVNRQLLGSAYNMHRSWEYDLLDG
DLLKEGVNELQVILHSPTQYIKEENAKVYTGGSHEAMEGFPHLRKAHCMFGWDWGPRVPD
AGIYREVSLVGVEKSRIESVYITQIHEEGSVTLDFDIAVETFTDQPEGTLAIQVTSPDGK
TYEYKERGEGEEEQFRIAITDPKLWWPHGYGDQPLYQVEVSLLSEDGKVLDSWKRRIGLR
TITVNTDQDEWGNRFAHEVNGVKIFAMGADYIPEDNLLSRVTRERTGKLLRDAVWANHNC
IRVWGGGYYPEDFFFDLCDELGLLVWQDFMYACASYELDDEFERNIIAETIENVRRIRHH
ACLALWCGNNEMETQTLDGIWLTTAKQKADYTKIYEYIIPKICKAEDPATFYWPSSPSSG
GSYDNPWDEARGDAHYWDVWHGEKPFTDYRKYHFRYLSEFGFQSFPSLKTVESFTLPEER
NIFSRVMEMHQRNTAANGKILKYLSATYLYPKDFAHLLYASQLLQADAIRYGVEHFRRYR
GRCMGAVVWQLNDIWPVASWASIDYYGRWKALHYAERKMFAPVMISCEETGELSERPYCI
AEPKPIEKSGTLHVANETFEAVTGIVRWSLRDSESKVLESGEETVTVPALDGVWLEKKDF
SSYDEREIHMTYSFIVDGKAVSENTCLFTAPKHYYFKNPNLSLKQEGSRITVTADAYAKN
VELYDESGDVRFSDNYFDMDAGEYTVEIIEGTPENLKCRSVFDIA

Enzyme Prediction     

No EC number prediction in MGYG000004114_01442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	775	1.7e-105	0.7593085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.82e-89	6	646	15	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	8.83e-17	4	431	42	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	9.37e-15	196	300	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	2.04e-13	758	823	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	5.28e-13	672	753	5	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK00272.1	0.0	1	824	1	815
AUS95659.1	0.0	1	824	1	802
QIB55233.1	0.0	6	824	7	808
QMW76907.1	0.0	6	824	7	808
QBE99964.1	0.0	6	824	7	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	2.22e-147	1	803	3	826	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.28e-147	1	803	3	826	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.62e-146	1	803	1	824	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.67e-146	1	803	3	826	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.04e-143	24	817	23	832	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	1.64e-103	24	811	24	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1CGA8	6.61e-102	31	645	32	658	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	2.57e-99	31	811	32	830	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q95327	7.22e-99	6	644	25	692	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
B0YBU9	9.67e-99	31	811	32	830	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004114_01442.