CAZyme Information: MGYG000004114_01640

Basic Information

• Species: CAG-95 sp000438155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000438155
• CAZyme ID: MGYG000004114_01640
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		90030.8	7.1106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004114	2992180	MAG	United Kingdom	Europe

• Gene Location: Start: 45794; End: 48205 Strand: -

Full Sequence      

MDELLGKMTLWEKISLLSGKDVFTSKALPRLQIPSICFSDGPHGIRKQLGDADHLGIHQS
CKATCFPTAVGMAVSWNTELIEQIGECLGEEAASLGVNVLLGPGLNIKRNPLCGRSFEYF
SEDPYLSGKLAAAYIRGVQRKGVAACPKHFAVNSQENLRMVNNSIVDERTLHEIYLTGFE
IAVKEGSPQAIMTSYNKINGIYSNENRELLMDILRRQWKFQGAVITDWGGSNDHVEGVRA
GSSIEMPGTGGDSDRQLLEAVKRKDIEEKVIDQRASEMLKLIEEAGNHRKDAYSVKEHHE
MAYQAALESMVLLKNEDNLLPLRKGARAAVIGEFAEKPRYQGAGSSLVNPTCVEHTMKHL
KESGLNVVGYAKGYERGKAFVEAWMSEAEKLADVADVVLYYMGLEETSECEGKDREDLAI
PENQRILLERLSNGKRKIAVILSSGSVVDLAWEMQAQTILYTTLAGQAQARAVVDIITGK
SCPCGKLTETWPVCYEDTPAASYYKKDQYDSLYKEALYVGYRYYSTVQQPVRFPFGYGLS
YTDFRYEELQISSEGVTFEITNAGSYDGAEIAQLYVGKPEQVPWGPGRELKGFVKVWLKA
GEKRTVKIVFDDKTFRYYNTEKKAWITPKAEYEILVGANVEDIRLRGRWIPEGTTESWQS
KGKKVPFPYTSGQIRQIPDQEFEALLGHEIVRTEHETGAPLRMNDAICKMADADSSAARA
VFRIIRKCKERGEQKEIPDLNILFIYNLPFRGIAKMMNGKVSLQMTGALLTIVNGELGKG
LKNLIKGYLDNRKYHRNEQRRKT

Enzyme Prediction     

No EC number prediction in MGYG000004114_01640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	27	247	1.8e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.34e-83	2	644	39	758	beta-glucosidase BglX.
COG1472	BglX	1.25e-79	29	338	56	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.79e-53	4	637	56	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.91e-45	310	541	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.30e-40	11	281	45	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN29197.1	2.89e-302	3	793	6	799
QRT31068.1	4.29e-283	3	801	5	806
QEI32524.1	4.92e-282	3	801	5	806
QHB25014.1	4.92e-282	3	801	5	806
SEU00071.1	1.98e-280	3	796	5	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.77e-187	3	646	7	663	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.07e-155	5	681	9	710	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.25e-123	1	647	4	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.90e-122	1	647	4	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	8.10e-94	1	643	6	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	9.70e-187	3	646	7	663	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	2.30e-149	8	666	12	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.55e-148	8	679	12	717	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	2.55e-119	1	644	46	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BB53	1.58e-106	1	643	6	823	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004114_01640.