CAZyme Information: MGYG000004114_01771

Basic Information

• Species: CAG-95 sp000438155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000438155
• CAZyme ID: MGYG000004114_01771
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MGYG000004114_21|CGC1	66963.91	8.0745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004114	2992180	MAG	United Kingdom	Europe

• Gene Location: Start: 13039; End: 14799 Strand: +

Full Sequence      

MNRIRIFFSTFSRKTKKHFLESTFMTKWDYLAMGVLTLFFTILVFYRIGNTSAPQSAYTA
TSEDRDIVIDLGDYVDVGSIHMFLGNLNTRKFSISAFNEVTGAWEVLQGETAAESVFAWN
TIAINYNLRYLGIVALDEECVIHELVLTSPDGTILSPIYDAKYSALFDEQDLFPAVKTYL
TGTMFDEVYHGRTAYEFIHGLVTYETTHPQLGKILISLGIRMFGMTPFGWRFMSALFGIF
MVPLFYLFAKRLFQNTFAATATTILLVFDCMHFMLSRIATIDIFVAFFIILAYYYLYRYF
LADHQYRQTSECLSDPFPPFRVAVLLALCGIGMSLAIATKLTGVYAAAGLAILFIWYTIL
HFPKQQTLRLFLFCIGFFVILPLVLYTLAYIPVVGADGYNGLIDKTIKNTRYMLWYHSTL
KAEHYYSSPYYEWPVIWMPLLDANDAVSATKVSAVSCMGNPAIWWVGIPCVLITFIQWIA
RRDGKAGFLTIGYLAQYLPWVILGLSGGRITFIYHYFPAILFTILMMGYVIHLLLTKFPK
SKIAITVYLVIAIACFFVFYPVVSGFPVSREYGMHLRLLKDWILVL

Enzyme Prediction     

No EC number prediction in MGYG000004114_01771.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	183	392	5e-51	0.9013452914798207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	2.37e-22	413	580	10	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	1.83e-18	179	433	62	302	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	1.22e-16	403	584	498	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG4346	COG4346	6.98e-15	204	515	132	393	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.06e-14	185	390	23	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF42044.1	4.43e-142	9	585	324	921
BCN30459.1	8.59e-130	25	585	487	1059
QNM01664.1	1.97e-102	26	585	482	1086
AQZ49137.1	6.07e-96	15	582	457	1049
AVF24955.1	6.34e-96	15	582	460	1052

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	2.35e-23	184	571	72	510	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.35e-23	184	571	72	510	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	9.76e-21	184	570	66	503	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.72e-18	199	582	94	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999987	0.000059	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
30	49
227	249
278	297
317	339
344	363
370	392
462	479
486	508
513	535
547	569