CAZyme Information: MGYG000004116_00583

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000004116_00583
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722	MGYG000004116_3|CGC1	84108.1	5.4219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004116	3787047	MAG	United Kingdom	Europe

• Gene Location: Start: 5570; End: 7738 Strand: +

Full Sequence      

MQYQLTKGWSVLQDVHEFGEHFGIFKHSFDPTRFGGDSSIQPLEPWEPIDRLEHLQLTFA
QNPYYGRELRTFNYAPWWYKNEFIVDDEYPYAVLQFTGVDYFADVWLNEEYLGFHEGYNT
PFCFEVGRLLKRGEKNLLVVKVRAPWENDILPGLEYIRFCTVIRDQMKGTYEHSDTFVPR
DVNPIGIWDRVTLETYNGVRLREKAWVAPTLNGDYSQADVHLSYRLHSEQDATSVRAVME
ITRFGDTEVVAREEKLLTLRNGKNLLEGCLTVENPRLWTVWERGEANRYTAILRLFAGEE
CLLSERQHFGIRDVKLMRTPEETTFYLNGERLYLRGATYFPDVYLSAVCRERYVRDIQNA
RAAGMNVLRVHVHAEKDDFYELCDEQGILLMQDSDFNWVHPATQEWGRRAVMMFEEMLIR
LRNHPSIFCWVLLNEPRGDNFLHECPGPQFVEAAARMDPGRPTILSSWDRNDPDSGDSHN
YMGSLDGAHTHYTDIYGTTEKLNTEFGMDAPPCLETLRHEPQLLKILGKVVDGIGHIQYY
QYRYIKYFIEHYRIQKFSPCAGHLQFLFTDCAPTSHFGVYDWKGLPKYAVRAFEESNQPL
GILMETKKEEPVALWAVNDLLRDFPGATAFWLIIDDCGEVIQRESRNLDLPANGKVKVAD
YDFVPVAGRQYTVRLELRDGDGKLLAKNLYEQAFNPPPHVKGHPTYVHHGIGLRTYWAWM
ED

Enzyme Prediction     

No EC number prediction in MGYG000004116_00583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	72	688	5.8e-82	0.6781914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.99e-40	74	436	62	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.49e-24	78	462	68	444	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.14e-19	79	461	113	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	1.66e-10	610	690	1	84	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam02836	Glyco_hydro_2_C	1.12e-09	325	462	8	157	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU02238.1	1.03e-205	4	718	6	722
CBL20454.1	1.51e-202	4	718	6	722
QBE94705.1	2.91e-194	5	718	7	722
QIB56389.1	3.72e-192	5	718	7	722
QMW80836.1	3.72e-192	5	718	7	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.14e-40	52	690	54	744	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	2.32e-25	75	681	69	757	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.33e-25	75	681	69	757	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	9.34e-25	75	681	67	755	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.24e-24	75	681	69	757	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	1.38e-24	25	463	23	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q5B7W2	9.13e-21	186	689	183	758	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q56F26	1.42e-20	42	690	77	765	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
Q82NR8	6.75e-20	75	696	120	776	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
A1D911	1.46e-19	2	678	6	699	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004116_00583.