CAZyme Information: MGYG000004116_02362

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000004116_02362
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	MGYG000004116_14|CGC1	89718.09	4.8368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004116	3787047	MAG	United Kingdom	Europe

• Gene Location: Start: 47976; End: 50321 Strand: +

Full Sequence      

MDHKAQWIWRQKKAADISEYMLFRKTVVYSRLPLQVNITVTADSCFILYVNGQRILRGPA
KSDLSLRYTDTVELTPYLQIGENVLAAEVIHYPGNRHLANEFKAGPTAQVSSMQGGLLIY
GDPDWQTDETYRCLPLEAYAFTPVDDTDLMYMGHFEAVNGALYPTGWKDPGFLDADWQPA
VPVAVNAPYIMGGLANVWQVEPDPIPLPYEEAVALRRITRCAPEIADRAEAFLSGGWLEL
SARENAWLELDAGEYRTAFPEWEIQGGREAEIHFLYAESYGFDRDGEYIKEKRDDCCRQG
SYLKGGEDVYFADGRSQQYAPFHYRAFRFIRLEIRGGEEPLRLRLKALRQTGYPLAVQSR
FHCGKEPLDQIWEVSLRTLKSCMYDTYMDCPYYERMQYLLDTRLEALYGYAVSRDDRLAR
KALRDFYNTQLPNGLMPCHSPSNILQIIPTFTFYWIMMLGDHYLYFGDKNLIESYYPGVE
KALAYFTDRLDDRGLLSDTGFWQFVDWTPEWSRGVPVKEPHEVNIIHTLMLVYVLRLAAD
LAEVTGRSSCAEGYHWLADRIDQAVNLYAYDEMRGLYTDTVGRPQWSQHAQIWAVLSGVA
DGERAKTVMVAAMENEAVAQCSFCMQYFLFRALEKAGLYEVSRVQWQLWEQMLRLGVTTW
PEDPVTWRSDCHAWSAVPLQELMTRGVGLRPAEPGFTRVHIAPRMYWLEECEGSCMTPYG
RISVAWEIRRGELTVKVDAEQPVPVCWELIDGQRMEETISGRVIRSVLLEPEKAVAAVKP
D

Enzyme Prediction     

No EC number prediction in MGYG000004116_02362.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	250	738	1.1e-105	0.9563492063492064
CBM67	5	184	1.2e-31	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.71e-29	349	687	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.09e-07	688	745	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.97e-07	48	185	18	155	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
COG3408	GDB1	5.72e-04	418	566	304	458	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	7.77e-04	530	609	207	296	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK59208.1	2.90e-187	1	762	1	765
QJD82735.1	1.51e-172	5	764	13	783
QTH41582.1	3.53e-167	5	745	9	769
BBH24613.1	4.94e-167	4	753	8	788
QTH40607.1	1.26e-165	4	737	8	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.10e-55	248	758	439	950	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	5.81e-19	318	741	264	687	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004116_02362.