CAZyme Information: MGYG000004116_02879

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000004116_02879
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555		61959.97	4.6664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004116	3787047	MAG	United Kingdom	Europe

• Gene Location: Start: 12095; End: 13762 Strand: +

Full Sequence      

MEFLPYGSFSPAGELLRRLMMSYSRLESPLYGAEIFDKSAEENPQWPGDWEGRTILAVVM
LAKATGREPENLKPLLQELEKRINQDGYMGPLIQEGRINEQLLAGNSWVMRGLCELYEWR
RDEKTLEAIRNMAEGLFLKTSGTYAAYPITKGSRQQGEGREGGNLTGEVNQGWLSSTDIG
CAFIMLDGASHAYHLLRTPQLRELITDMISRFAQADLTGATFQTHATLSAVRGILRFYED
TGEEKWLELAKKVFAYYAENGMTENYANHNWFGRPEWTEPCAIVDSLLSSATLWRMTREP
GYLELAHNILYNALYYAQRANGGFGCDNCAGAFEPTLRPSGEASYEAWWCCTMRGADGLS
NAASYMAAEEMGTLYLPFYQEGVFTAKGLKLRETTAYPYTGRVTLEVLENTGEVSSIAFY
RPSFVRFFHVQGGEIAGEDSGFVTVKGSWLPGDRIEVIMELSLWTADARSPAFEGWQTLR
YGTLLLAAPSGSWPAIMPDLDRLVLEDAQGAVFAAPDGRHFSPVGRMTFTSKEEILSTPL
QVLFEARSRSGDGKE

Enzyme Prediction     

No EC number prediction in MGYG000004116_02879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	222	487	8.3e-19	0.5546719681908548

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	7.58e-19	230	487	231	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.44e-10	226	463	223	478	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	0.001	190	350	556	709	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG4225	YesR	0.007	230	324	41	122	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ98268.1	2.25e-131	9	490	8	496
BCI61757.1	1.27e-118	4	503	31	535
QGA23470.1	1.17e-105	13	455	41	485
QOY91325.1	4.28e-23	33	457	61	472
SNV45513.1	1.86e-14	279	542	341	603

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004116_02879.