CAZyme Information: MGYG000004116_02957

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000004116_02957
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746	MGYG000004116_24|CGC1	85140.96	5.02

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004116	3787047	MAG	United Kingdom	Europe

• Gene Location: Start: 4176; End: 6416 Strand: -

Full Sequence      

MDYPMHYIYAGPAYSTLTEYVPAPYLRKSFHLKTLPEKAELLICGLGFYELYINGRRITK
GLLAPYISNPDDLLYYDDYDLLPYLREGENVLGICLGNGFQNNPGGYTWDFDKARFRGAP
EMALRLDVDFSDGETLSLESDETFRTAPSPIYGDDYRNGEYYDARREIPGWCEPGFDDSG
WAFAKKAPLPRGEAVLSRIEPITVAREIQPVSVIPFEDGYLYDFGEDAAGVCRLTIQGEA
GQIISLYHAESIKEGKLDRRSISFDENDYVQKDIYICKGEGVESYTPTFTYHGFQYVLVK
GLKPEQADKSLLTYVVFHTRLRERGGFSCSDETINALQAMVRRSTLTNFHHFPTDCPQRE
KNGWTADASLSTEHTLLNLEPDKNYHEWLRNIRKAQADDGSLPGVVPTGGWGFAWGNGPA
WDNILVYAPYMTYLYRHDKAILKENAHAILRYLDYLTTRIREDGLICWGLGDWCPVGRFA
DHYKSPLEFTDTVLSMDICEKAAYIFGELDMAEQKAFAMGIYHRLRQAGRERLLDLSTMT
ALGRCQTSQAMAIFYSLFDEGEKPEAFRRLLEFVHEYDDHMDVGVLGGRVIFHVLADYGC
SDLAYKMIARPDYPSYGEWLSHGATTLREQFLQDERFSLNHHFWGDISHWFIRHLAGICY
NPRRRGAEADIRPSFVEQLTFAEGWHEAPEGKIAVRWERTEEGIRLNVQAPEGLYGRIYL
PQGYLFAEDRLAVKPLCSGSYAITAG

Enzyme Prediction     

No EC number prediction in MGYG000004116_02957.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	218	720	2.6e-118	0.9861111111111112
CBM67	20	187	4.3e-35	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.05e-72	322	655	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.90e-38	36	204	3	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.71e-22	220	317	8	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.23e-09	671	721	14	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	3.18e-161	21	724	141	844
AHF16194.1	5.05e-154	23	731	172	873
QGA23306.1	1.29e-150	20	718	158	860
ANH83620.1	8.28e-148	22	746	139	868
ASU33388.1	3.84e-146	22	741	160	888

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	8.77e-107	23	734	176	908	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.57e-86	31	744	307	1029	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.20e-66	27	697	135	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	6.25e-95	23	725	184	911	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.19e-85	31	744	307	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.14e-75	25	721	176	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.27e-69	11	724	161	882	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004116_02957.