CAZyme Information: MGYG000004119_01371

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-354
• CAZyme ID: MGYG000004119_01371
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
819		93732.37	8.6063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004119	1590102	MAG	United Kingdom	Europe

• Gene Location: Start: 11283; End: 13742 Strand: +

Full Sequence      

MLKYKELIDKMTLEEKAGLCSGQNYWCTKEIKRLNIPSIMMTDGPNGLRVQRGKTDEFGI
KLGNKATCFPTESTISNSWNINLIYEEGKAIAEEAKEERVSMVLAPGVNIKRSPLCGRNF
EYFSEDPFLAGKLGIAYVKGMQDQGIGACVKHFAANNQEERRMTIDVIVDERTLREIYLT
AFEMIVKEARPWAVMSAYNRINGEYCTENKKLLGILREEWGHQGIVVTDWGAENDRVKGL
MAGNDLEMPATDGRTDKEIVEAVKQGKISEEILNETVDRMLEFIMKSNENLREKEKYNRK
KHKELAQKLAEESIVLLKNESSILPIKKGYKIALIGDMAKYPRYQGAGSSITNPEKVDSI
YECLKEKEINFEYEKGYDRKTSKKDKQYRKKACEIAKEKDVVLLCIGLTENEETEGMDRR
TLKLSENQVQLIEELKKVNSNIVVILCGGAPIEMPWIQGIKGIVHGYLGGQAGARAMVNV
LLGEVNPSGKLAETYPMQLEDTPCFENFPGSQTCVEYKEGIYVGYRYYDKVGKRVLFPFG
YGLSYTEFEYSNLEMEKTKFEIEKEEKIKVKLTIKNIGKMSGSEIVELYVSQKDPVIFKP
KKELKGFEKVFLAPEEEKEIIIELDRRAFSYYDVEYGLWKVESGIYDILIGKSSEEIILK
QEIEIISSDVISNKEYPVSYQTANLPAISDQDFAMVLGRKHLIKRPKIKKITEAHTMEDA
KHTLIGGAIYYYQSKIKLKSLLKKQNIIKASKVMMDLQKPLRVFARKQNEIYNQETVAGF
IKVLNGHWIKGVKQIYEGRKKYSRKTKNGKNKDFEEKCK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	1.7e-67	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.50e-79	6	657	40	757	beta-glucosidase BglX.
COG1472	BglX	4.11e-77	11	356	1	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.99e-65	7	610	56	728	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.23e-59	314	525	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.02e-40	29	282	59	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHZ46303.1	2.84e-254	2	809	1	804
ANY69910.1	9.21e-254	2	801	1	798
QHZ46306.1	1.74e-253	2	807	1	803
AOZ92946.1	1.20e-251	2	799	1	795
AST96263.1	1.75e-250	2	801	1	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	6.31e-248	5	729	6	723	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.88e-175	8	657	9	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.87e-142	1	660	1	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.06e-140	1	660	1	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.62e-115	5	665	7	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	3.46e-247	5	729	6	723	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	6.51e-174	8	657	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.61e-171	8	657	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	2.15e-132	2	657	44	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	1.32e-122	5	663	12	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004119_01371.