CAZyme Information: MGYG000004122_02186

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; AM07-15
• CAZyme ID: MGYG000004122_02186
• CAZy Family: GH3
• CAZyme Description: Exo-alpha-(1->6)-L-arabinopyranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		28128.11	7.4112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004122	2305266	MAG	United Kingdom	Europe

• Gene Location: Start: 1301; End: 2077 Strand: -

Full Sequence      

MEQCFENGFLARGEYNPGGTRHYQYCTAFPIGTMLAQSWNTCLLQEVGAAVGYEMALFGV
SLWLAPGMNIHRSPLCGRNFEYFSEDPLLSGQMAAAITRGVQSCPGCGVTLKHFACNNQE
TERLESNSLVSERALREIYLRGFQIAVQSAQPSAIMTSYNLVNGVHAANSAALCTAIARC
EWGFAGIFMTDWDTTSSRRCTAEGCIQAGNDLLMPGNRREYSALLCALRDGRLDRRLLRS
CAGRIIKTALGLSAPTAP

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	17	215	3.9e-62	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.83e-52	17	252	69	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.33e-29	27	246	86	314	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.10e-18	27	193	112	299	Probable beta-xylosidase; Provisional
PRK15098	PRK15098	2.29e-17	27	191	118	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL20304.1	9.90e-100	6	254	569	818
QCO92985.1	9.90e-100	6	254	569	818
QQQ93533.1	2.24e-99	3	250	584	833
ANU75960.1	2.24e-99	3	250	584	833
ASU28771.1	2.24e-99	3	250	584	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	7.83e-67	25	247	77	302	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.12e-65	25	247	77	302	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WUG_A	7.25e-51	27	254	584	824	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5WAB_A	1.29e-49	27	234	69	270	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	6.62e-49	27	247	68	284	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	6.47e-49	17	254	521	767	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	8.29e-49	27	192	606	770	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
F6C6C1	2.67e-48	27	233	69	269	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P14002	3.62e-48	27	247	68	284	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	9.60e-48	27	231	69	267	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992933	0.006847	0.000077	0.000026	0.000026	0.000071

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004122_02186.