CAZyme Information: MGYG000004124_00308

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; QAKW01
• CAZyme ID: MGYG000004124_00308
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233		26617.87	5.457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004124	1823169	MAG	United Kingdom	Europe

• Gene Location: Start: 39929; End: 40630 Strand: -

Full Sequence      

MKKLLKYSVLSICAVIFLIGAIITVKGYAMYCKVLRDNPPAQAIEKIKSDEDYVSIDVLP
QMYLDAVIAVEDRRFYYHPGIDIISIGRAVLTDIREMKLVEGGSTITQQFAKNIFFTQSK
KFERKIAEMFMALRLERMYTKDEILELYVNTIYFGSGYYSVRAASLGYFDKEPWELSDYE
STMLAGLPNAPSVYSLDNNPELASQRQAQVINKLVKYGYIKEEEGERILSCAP

Enzyme Prediction     

No EC number prediction in MGYG000004124_00308.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	214	7.4e-61	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.03e-78	52	215	14	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	5.64e-76	53	227	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.47e-71	1	224	15	250	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.67e-68	1	226	1	242	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	9.67e-47	12	230	8	236	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	2.90e-83	1	230	4	233
QYX26381.1	4.11e-83	13	228	9	230
QNM09777.1	3.28e-82	4	229	22	241
QJU22158.1	5.31e-77	15	223	17	225
ASB42272.1	8.85e-77	6	231	7	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	7.29e-52	53	230	22	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.93e-51	53	230	22	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.94e-39	30	230	38	242	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3VMQ_A	3.00e-39	30	230	55	259	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	4.46e-38	44	230	14	206	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	8.36e-47	53	230	65	242	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	4.70e-44	54	224	70	240	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q07259	1.03e-41	36	224	32	219	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
Q99T05	1.91e-38	30	230	61	265	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=mgt PE=1 SV=1
Q2YU13	1.91e-38	30	230	61	265	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.725452	0.264362	0.006423	0.000827	0.000522	0.002428

TMHMM  Annotations     

start	end
7	29