CAZyme Information: MGYG000004124_00452

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; QAKW01
• CAZyme ID: MGYG000004124_00452
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598		68210.64	5.8852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004124	1823169	MAG	United Kingdom	Europe

• Gene Location: Start: 14394; End: 16190 Strand: -

Full Sequence      

MKLFDCDKVKITGGYIADKQKLNRKVIINAVYDRFCDSGRIGAFDFDWIEGKPNKPHYFY
DSDVAKWMEGAAYILHDNPDSELKGRVERLIDKIEEHQDGDGYFNIYFTVCEPEKRFKDR
DKHELYCAGHLFEAAVAYARATGETRFLKCMEKYADYIYRVFVIEKSAAFVTPGHEEIEL
ALIEMYRYTKVKKYLELALFFLNNRGKCESEKTPYNQSHLPVREQTEAVGHVVRAVYLYS
AMADCAFETGDNELKRACFALFEDIVTKKMYVTGGLGSTPIGEAFTHAYDLPNNDAYAET
CAGIGLMFFAKRLLRLENRAEFADVIERVFYNGVLSGLSLDGKAFFYENPLEITLSEHFE
SVYGKRRLPITQRVECFKCSCCPPNLNRLLPKLSEYIYGLESDTLFVNQFAESVLSDGKT
ECKMHTDYPRSGTVKISACGVKNVAVRIPSWCAKFTADREYTVKDGYAVMESGGEITLRF
DMSPFAVYADSRVVHDTHRLCIQAGPVVYCAEGIDNCEVSENLHALCVPHDFDYRIEYDE
SIGLNTLNISGFRIKSAKNTLYSRDKGETEPVTIRLIPYSAFANRGESDMLVWLHAKY

Enzyme Prediction     

No EC number prediction in MGYG000004124_00452.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	9	510	1.2e-164	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	2.22e-154	8	597	11	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	2.09e-124	9	510	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96918.1	4.72e-174	7	597	15	628
QHQ63226.1	1.71e-162	7	593	12	621
AZN43118.1	2.42e-152	9	597	18	657
AGB41651.1	2.50e-144	1	594	3	643
BBH85646.1	8.39e-144	9	594	15	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	4.17e-141	30	597	41	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.04e-135	30	597	41	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	5.49e-107	9	594	15	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	5.36e-92	59	593	73	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	6.96e-92	59	593	73	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.94e-91	59	593	73	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004124_00452.