CAZyme Information: MGYG000004127_00438

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae
• CAZyme ID: MGYG000004127_00438
• CAZy Family: GH55
• CAZyme Description: Exo-beta-1,3-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		31463.12	6.7815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004127	2215894	MAG	United Kingdom	Europe

• Gene Location: Start: 2; End: 880 Strand: -

Full Sequence      

MTPGVYQLDRPIEVRRADTVVLGMGHATLTAANGTAAMTVADTSGVVVAGVTFDAGEKLS
PVLLRIGKATGGGHRHKADPRNPVTLSDTYFRVGGPHVGKVTTAVEINSDHVLVDHTWVW
RADHGVEGFTEGVNGDTDRWRTNLGSYGLVVNGDDVTATGLFVEHFQKYNTLWKGERGRV
ILYQNELPYDPPTQADWTRPDGTLGYPGYKVADKVRRHSLSGAGVYVFNQNNPSVLTANG
FEVPDRPGVRLHHVMTVNLSAGTIQHVVNGIGGQADNTNTGTPQFVVDYPTP

Enzyme Prediction     

EC	3.2.1.-	3.2.1.58	3.2.1.39

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	2	280	3.8e-63	0.4283783783783784

CDD Domains     

MGYG000004127_00438 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ19708.1	3.19e-164	1	292	337	625
VEH37064.1	5.80e-161	1	290	97	387
QCB95092.1	2.74e-152	1	290	323	624
QHT58439.1	7.18e-151	1	290	327	617
ASR55147.1	2.42e-149	1	290	352	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PEW_A	1.39e-76	2	290	288	561	Structureof sacteLam55A from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4PEW_B Structure of sacteLam55A from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
4TZ1_A	8.15e-76	2	290	276	549	Ensemblerefinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritriose [Streptomyces sp. SirexAA-E],4TZ3_A Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritetraose [Streptomyces sp. SirexAA-E],4TZ5_A Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminarihexaose [Streptomyces sp. SirexAA-E],4TZ5_B Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminarihexaose [Streptomyces sp. SirexAA-E]
4TYV_A	8.54e-76	2	290	278	551	Ensemblerefinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with glucose [Streptomyces sp. SirexAA-E],4TYV_B Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with glucose [Streptomyces sp. SirexAA-E]
4PEX_A	1.07e-75	2	290	288	561	Structureof the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with glucose [Streptomyces sp. SirexAA-E],4PEX_B Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with glucose [Streptomyces sp. SirexAA-E],4PEY_A Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritriose [Streptomyces sp. SirexAA-E],4PEZ_A Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritetraose [Streptomyces sp. SirexAA-E],4PF0_A Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminarihexaose [Streptomyces sp. SirexAA-E],4PF0_B Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminarihexaose [Streptomyces sp. SirexAA-E]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2NFJ9	2.02e-75	2	290	332	605	Exo-beta-1,3-glucanase OS=Streptomyces sp. (strain SirexAA-E / ActE) OX=862751 GN=SACTE_4363 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000042	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004127_00438.