CAZyme Information: MGYG000004128_00412

Basic Information

• Species: UMGS1253 sp900550065
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UMGS1253; UMGS1253; UMGS1253 sp900550065
• CAZyme ID: MGYG000004128_00412
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1416		154935.15	4.6672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004128	2239270	MAG	United Kingdom	Europe

• Gene Location: Start: 17378; End: 21628 Strand: -

Full Sequence      

MLKNKAVVWALIMAFVLSCFPAVSFAAEDAVGEAIFYNRTYDEAGKEPTEGLSVIPKSNS
IAPEKDSKNNQYMKIEMADPVTEDCYIEVAMPNPTKHIVIEMDLSTTKAGVSGNIQFKDQ
SRKDGLLMKIANDGKVTSAGSGKELGTVKKGAWLNVAFALNLETLTYSSYVAGKQVEKDV
PVSGSAVGMILVRLYIEGKGAGANLLVDNLKIYEATAPKDITGKDVQGPTTTFAPSATPA
PSSVPTPSGNVTMKGKTALFDCDSKKDIEALGLKADTKNVKDTKYSAAWKFSDKPNLIFS
KISGDLRCYTEFSFNIYNSSDKEQKLYLRFDSQNAETTDGDDYYGTSLTLPPKAWTEVNK
TLSSLGKTRTPIGWHQIDSLKLFSTGWGMENDPETVLYLDTIYFDGSNAVATPTPTANPT
DLSRVNDAVCLKLDCPSALVKKAKKPIDENNENVVPFTSNDRTLVPVRFIAEGFGADVGY
DGATEKVTVKLGSDTIELTIGSDKIYKNGQEIKIDTAATVTGDDRTFVPLRAIAEALGKE
VFWDDMGLIVISDTKDIFNRETDLSLMLNVMAEFTYERPEGSKIIADLKENAPQHPRILA
NADDFARIKSLYETDPLLKEWADKILKTADNMASSAQPPVYSVDDGGRLKGTNTESYMLQ
WGLAYQMTGDKKYVDAAYDHLKVICGFDNWHPGHFLDAAGIMKGVAIGYDWMYDGFTADQ
RKVIEEGLYKHGIKAGLGAYAGTTEDMEPKHGTFGRSGWTNTDNNWNAVCNGGLTLACAA
IGDLAAYEKDAGDLMGKVLKSIEKGIRCYAPDGSYPEGPGYWAYGTNNLFYMIECLDSAM
GTDYGLFNAPGLDTTCYFPNYIEGTNGMWNFNDCGEGNVDTSHLFWVANKIGNPDLAGMR
LQDIVNGKKNAGIHDILHYDPNNINREVHLALDRYMTGVQTVTMRGDWNDSGTVFTGLHG
GYNGVNHGNLDSGNFIIDAGGVRFISDIGTENYNLPSYFSGGVGGQRWTYYRNRAEGHNT
ITINPGTSEDQVVSATTKITRFESKPRGAISVVDMAPAHGSKVKNAQRGLLFTDNRKAVV
MQDEMTLSSASEVWWFAHVQDGEITVAADGKSAIIEKQGKRMWAGIVSDMADAKFEVMAA
DPLPTSPKKNDAEYDRSAWKKLAIHTSGVTDYKLAVVFRLLEGSQTEPNYKYTYTAIKDW
TIPDGEIVVPRLTDLTVDGQTVDNFSPLATNYKVILPYGTTAVPTVEAKADDGYTVEVTQ
AQALPGLATVKVYATDDPGTYNIYDITLRAMAEIEVEASDIPEPANVPENTLDGDLGTRW
AAEGEQWIKYTFANPREISAVWIAFWKSDARSTMFKLEISKDGETFETVFDGTQTNKEDT
LAEYKLPAPTTVKAVRISGTGNTSNAWNSILEVEFK

Enzyme Prediction     

No EC number prediction in MGYG000004128_00412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	953	1129	3.2e-47	0.9720670391061452
CBM32	1303	1413	3.1e-20	0.8709677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	1.09e-31	459	545	1	86	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam00754	F5_F8_type_C	2.12e-15	1295	1413	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07833	Cu_amine_oxidN1	2.27e-08	453	489	57	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07940	Hepar_II_III	0.007	953	1028	25	89	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
smart00231	FA58C	0.009	1298	1415	16	136	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS27107.1	2.32e-162	576	1412	678	1507
QNK58643.1	1.20e-151	576	1414	773	1607
QNK56587.1	3.39e-150	594	1414	220	1024
AZS17848.1	1.12e-149	423	1413	275	1274
SDS98549.1	4.13e-144	593	1413	50	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D29_A	2.40e-19	1306	1413	22	129	CBM32of AlyQ [Persicobacter sp. CCB-QB2],7D2A_A CBM32 of AlyQ in complex with 4,5-unsaturated mannuronic acid [Persicobacter sp. CCB-QB2]
5XNR_A	2.32e-17	1306	1413	22	129	TruncatedAlyQ with CBM32 and alginate lyase domains [Persicobacter sp. CCB-QB2]
2JD9_A	9.47e-14	1303	1413	21	131	Structureof a pectin binding carbohydrate binding module determined in an orthorhombic crystal form. [Yersinia enterocolitica],2JDA_A Structure of a pectin binding carbohydrate binding module determined in an monoclinic crystal form. [Yersinia enterocolitica],2JDA_B Structure of a pectin binding carbohydrate binding module determined in an monoclinic crystal form. [Yersinia enterocolitica]
5ZU6_A	1.31e-13	1296	1410	35	151	ACBM32 derived from alginate lyase B (AlyB-OU02) [Vibrio]
5ZU5_A	4.77e-12	1296	1410	35	151	Crystalstructure of a full length alginate lyase with CBM domain [Vibrio splendidus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000756	0.618883	0.379577	0.000280	0.000256	0.000228

TMHMM  Annotations     

start	end
7	26