CAZyme Information: MGYG000004129_01971

Basic Information

• Species: Acutalibacter sp000435395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp000435395
• CAZyme ID: MGYG000004129_01971
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685		76726.08	5.0192

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004129	2343469	MAG	United Kingdom	Europe

• Gene Location: Start: 716; End: 2773 Strand: +

Full Sequence      

MRYTFQPYAKMPLVRGHLNLGGANPQGGRIDVNNLYLERDGKPWVPIMGEFHFSRGSRPH
WYRELCKMKAGGVTVVATYLFWIYHEEEEGRFDFTGDRDIRAFLLECQRAGLEAVIRIGP
WAHGECRNGGFPDWLLQKPYPLRDNNPGYLEKARLWYREIYRQVQGLSYQEGGPIVGIQL
ENELVNNAPHLLALKRLAQEVGFQAPLWTVTGWDNVCGAQIPVDEVLPVFGAYADAPWAS
TLEPLPPSHAFTFNRMRNDSAIGADQIAQTGQDGWRLPYERYPFATCELGGGIQVTYHRR
PRIRPMDVYALALCKLGAGNNLPGYYMYHGGTNKLGRFSTLNESKESGYPNDCPILSYDF
QAPLSQYGEARGQYGLLNLLHLFLQDFGELFAPMEAVEAQRLVPPEDSASLRYALRTNGE
GGFVFVNHYQRLHPLEDVLAAEIDTGSLCFPPLDVRGEVAFFLPYNLPVGGELLTWATAQ
PICREGNTLFFAAIPGIPPRYAFQGRDVLSPEPGLAPRQVGEMQLVTLPWEQAQYLRRLP
SGLYLGEGCSLYQEDGSLAAIEEGSFSAYRWEGQCFAPLAVERPFQPAALTREPLAAAPL
EAPTLRELFLGGERPVTWQRLSVSTAEGFVEIPGPYDVGQLYAGGQLVADSFYYGEPWRV
PASLLYGKECFLALSELGGNFYREF

Enzyme Prediction     

No EC number prediction in MGYG000004129_01971.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	39	381	2.3e-78	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	9.30e-47	39	375	4	309	Glycosyl hydrolases family 35.
PLN03059	PLN03059	1.63e-21	40	371	40	328	beta-galactosidase; Provisional
COG1874	GanA	1.80e-13	39	183	10	160	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.89e-05	61	184	12	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41311.1	4.46e-182	12	660	14	729
BBR82200.1	1.96e-178	1	660	1	680
QSS01693.1	3.13e-177	1	660	1	680
APV13328.1	3.13e-177	1	660	1	680
QDJ76141.1	3.13e-177	1	660	1	680

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	5.11e-30	28	386	26	352	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	2.69e-29	28	386	6	332	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3WEZ_A	4.90e-29	19	383	24	358	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3THC_A	5.91e-29	30	383	11	334	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WF3_A	2.04e-28	19	383	24	358	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58D55	1.37e-29	11	378	13	350	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q9TRY9	1.47e-29	11	393	15	367	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q5XIL5	5.17e-29	36	380	55	364	Beta-galactosidase-1-like protein 3 OS=Rattus norvegicus OX=10116 GN=Glb1l3 PE=2 SV=1
O19015	8.25e-29	11	411	15	392	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1
Q8IW92	9.43e-29	34	374	53	358	Beta-galactosidase-1-like protein 2 OS=Homo sapiens OX=9606 GN=GLB1L2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004129_01971.